Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3717820..3718436 | Replicon | chromosome |
Accession | NZ_CP099511 | ||
Organism | Lelliottia amnigena strain P13 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A3S5XV95 |
Locus tag | NFJ01_RS17805 | Protein ID | WP_059180558.1 |
Coordinates | 3718062..3718436 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NFJ01_RS17800 | Protein ID | WP_252688607.1 |
Coordinates | 3717820..3718062 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFJ01_RS17770 (NFJ01_17770) | 3712865..3713761 | + | 897 | WP_059180553.1 | sugar kinase | - |
NFJ01_RS17775 (NFJ01_17775) | 3713796..3714596 | + | 801 | WP_174343766.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NFJ01_RS17780 (NFJ01_17780) | 3714729..3715328 | + | 600 | WP_015961052.1 | glucose-1-phosphatase | - |
NFJ01_RS17785 (NFJ01_17785) | 3715322..3716194 | + | 873 | WP_131487116.1 | virulence factor BrkB family protein | - |
NFJ01_RS17790 (NFJ01_17790) | 3716191..3716628 | + | 438 | WP_059180556.1 | D-aminoacyl-tRNA deacylase | - |
NFJ01_RS17795 (NFJ01_17795) | 3716673..3717614 | + | 942 | WP_041689564.1 | fatty acid biosynthesis protein FabY | - |
NFJ01_RS17800 (NFJ01_17800) | 3717820..3718062 | + | 243 | WP_252688607.1 | CopG family transcriptional regulator | Antitoxin |
NFJ01_RS17805 (NFJ01_17805) | 3718062..3718436 | + | 375 | WP_059180558.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFJ01_RS17810 (NFJ01_17810) | 3718475..3719404 | - | 930 | WP_059180559.1 | formate dehydrogenase accessory protein FdhE | - |
NFJ01_RS17815 (NFJ01_17815) | 3719401..3720036 | - | 636 | WP_059180560.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFJ01_RS17820 (NFJ01_17820) | 3720033..3720956 | - | 924 | WP_015961045.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14003.14 Da Isoelectric Point: 7.4014
>T249044 WP_059180558.1 NZ_CP099511:3718062-3718436 [Lelliottia amnigena]
MAKGSALFDTNILIDLFSGRAEAKHALESWPPQNAISIITWMEVMVGAKKYHQEHRTRIALSAFNVLGVSQEVAERSVDL
RQEYRMKLPDAIILATAQIHRLELVTRNTKDFGNIPDVVTPYNL
MAKGSALFDTNILIDLFSGRAEAKHALESWPPQNAISIITWMEVMVGAKKYHQEHRTRIALSAFNVLGVSQEVAERSVDL
RQEYRMKLPDAIILATAQIHRLELVTRNTKDFGNIPDVVTPYNL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|