Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2624758..2625378 | Replicon | chromosome |
| Accession | NZ_CP099511 | ||
| Organism | Lelliottia amnigena strain P13 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A2S5C408 |
| Locus tag | NFJ01_RS12685 | Protein ID | WP_012016344.1 |
| Coordinates | 2625160..2625378 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A3S5XLQ2 |
| Locus tag | NFJ01_RS12680 | Protein ID | WP_059177928.1 |
| Coordinates | 2624758..2625132 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ01_RS12670 (NFJ01_12670) | 2619884..2621077 | + | 1194 | WP_252686077.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFJ01_RS12675 (NFJ01_12675) | 2621100..2624249 | + | 3150 | WP_252686079.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NFJ01_RS12680 (NFJ01_12680) | 2624758..2625132 | + | 375 | WP_059177928.1 | Hha toxicity modulator TomB | Antitoxin |
| NFJ01_RS12685 (NFJ01_12685) | 2625160..2625378 | + | 219 | WP_012016344.1 | HHA domain-containing protein | Toxin |
| NFJ01_RS12690 (NFJ01_12690) | 2625593..2626144 | + | 552 | WP_174342404.1 | maltose O-acetyltransferase | - |
| NFJ01_RS12695 (NFJ01_12695) | 2626262..2626750 | + | 489 | WP_252686081.1 | YlaC family protein | - |
| NFJ01_RS12700 (NFJ01_12700) | 2626701..2628161 | - | 1461 | WP_252686083.1 | PLP-dependent aminotransferase family protein | - |
| NFJ01_RS12705 (NFJ01_12705) | 2628261..2628971 | + | 711 | WP_252686085.1 | GNAT family protein | - |
| NFJ01_RS12710 (NFJ01_12710) | 2628968..2629108 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| NFJ01_RS12715 (NFJ01_12715) | 2629111..2629371 | - | 261 | WP_012016339.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8631.05 Da Isoelectric Point: 8.9039
>T249040 WP_012016344.1 NZ_CP099511:2625160-2625378 [Lelliottia amnigena]
MSDKPLTKTDYLMRLRRCQSLDTLERVIEKNKYELPDHELAVFYSAADHRLAELTMNKLYDKIPVSVWKFVR
MSDKPLTKTDYLMRLRRCQSLDTLERVIEKNKYELPDHELAVFYSAADHRLAELTMNKLYDKIPVSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14550.26 Da Isoelectric Point: 5.1481
>AT249040 WP_059177928.1 NZ_CP099511:2624758-2625132 [Lelliottia amnigena]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFNNVSRANPVSHSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFNNVSRANPVSHSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S5C408 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5XLQ2 |