Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 42227..42887 | Replicon | chromosome |
| Accession | NZ_CP099511 | ||
| Organism | Lelliottia amnigena strain P13 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3S5XTW2 |
| Locus tag | NFJ01_RS00215 | Protein ID | WP_059177602.1 |
| Coordinates | 42474..42887 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A3S5XU93 |
| Locus tag | NFJ01_RS00210 | Protein ID | WP_015960306.1 |
| Coordinates | 42227..42493 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFJ01_RS00185 (NFJ01_00185) | 37469..38902 | - | 1434 | WP_059177598.1 | 6-phospho-beta-glucosidase BglA | - |
| NFJ01_RS00190 (NFJ01_00190) | 39018..39749 | - | 732 | WP_059177599.1 | MurR/RpiR family transcriptional regulator | - |
| NFJ01_RS00195 (NFJ01_00195) | 39802..40113 | + | 312 | WP_252687074.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFJ01_RS00200 (NFJ01_00200) | 40277..40936 | + | 660 | WP_059177600.1 | hemolysin III family protein | - |
| NFJ01_RS00205 (NFJ01_00205) | 40979..41959 | - | 981 | WP_252687075.1 | tRNA-modifying protein YgfZ | - |
| NFJ01_RS00210 (NFJ01_00210) | 42227..42493 | + | 267 | WP_015960306.1 | FAD assembly factor SdhE | Antitoxin |
| NFJ01_RS00215 (NFJ01_00215) | 42474..42887 | + | 414 | WP_059177602.1 | protein YgfX | Toxin |
| NFJ01_RS00220 (NFJ01_00220) | 42892..43413 | - | 522 | WP_015960304.1 | flavodoxin FldB | - |
| NFJ01_RS00225 (NFJ01_00225) | 43514..44410 | + | 897 | WP_252687076.1 | site-specific tyrosine recombinase XerD | - |
| NFJ01_RS00230 (NFJ01_00230) | 44439..45152 | + | 714 | WP_059177605.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFJ01_RS00235 (NFJ01_00235) | 45158..46891 | + | 1734 | WP_252687079.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16260.13 Da Isoelectric Point: 11.1910
>T249034 WP_059177602.1 NZ_CP099511:42474-42887 [Lelliottia amnigena]
VVLWQSDLRVSWRSQWMSLLLHGMVAAFVLLMPWPLSYTPLWMLLLSLVVFDSVRSQRRINSCQGEIKLLMDSRLRWQGK
EWEIVGTPWMLSFGMMFRLRNVQGGRNQHLWLSADSMDADEWRDLRRMVLQQPTPGR
VVLWQSDLRVSWRSQWMSLLLHGMVAAFVLLMPWPLSYTPLWMLLLSLVVFDSVRSQRRINSCQGEIKLLMDSRLRWQGK
EWEIVGTPWMLSFGMMFRLRNVQGGRNQHLWLSADSMDADEWRDLRRMVLQQPTPGR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5XTW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5XU93 |