Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1132362..1132838 Replicon chromosome
Accession NZ_CP099508
Organism Staphylococcus aureus strain S82

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LPT18_RS05605 Protein ID WP_000052076.1
Coordinates 1132650..1132838 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LPT18_RS05600 Protein ID WP_001059690.1
Coordinates 1132362..1132622 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT18_RS05565 (1127760) 1127760..1128476 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
LPT18_RS05570 (1128624) 1128624..1129046 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
LPT18_RS05575 (1129445) 1129445..1129939 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
LPT18_RS05580 (1130088) 1130088..1130705 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
LPT18_RS05585 (1130778) 1130778..1131359 - 582 WP_001140696.1 histidine phosphatase family protein -
LPT18_RS05590 (1131584) 1131584..1131820 + 237 WP_000368687.1 hypothetical protein -
LPT18_RS05595 (1131817) 1131817..1132020 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LPT18_RS05600 (1132362) 1132362..1132622 + 261 WP_001059690.1 hypothetical protein Antitoxin
LPT18_RS05605 (1132650) 1132650..1132838 + 189 WP_000052076.1 hypothetical protein Toxin
LPT18_RS05610 (1133026) 1133026..1133595 + 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
LPT18_RS05615 (1133683) 1133683..1133967 + 285 WP_001004403.1 hypothetical protein -
LPT18_RS05620 (1134028) 1134028..1134246 + 219 WP_000005881.1 hypothetical protein -
LPT18_RS05625 (1134743) 1134743..1134943 - 201 WP_001059082.1 cold-shock protein -
LPT18_RS05630 (1135300) 1135300..1135986 - 687 WP_001574556.1 thermonuclease family protein -
LPT18_RS05635 (1136327) 1136327..1136809 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T249027 WP_000052076.1 NZ_CP099508:1132650-1132838 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT249027 WP_001059690.1 NZ_CP099508:1132362-1132622 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References