Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 119272..120048 | Replicon | chromosome |
| Accession | NZ_CP099508 | ||
| Organism | Staphylococcus aureus strain S82 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | LPT18_RS00765 | Protein ID | WP_000031108.1 |
| Coordinates | 119896..120048 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | LPT18_RS00760 | Protein ID | WP_001251224.1 |
| Coordinates | 119272..119871 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT18_RS00740 (115188) | 115188..116645 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
| LPT18_RS00745 (116638) | 116638..117360 | + | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
| LPT18_RS00750 (117511) | 117511..118638 | + | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| LPT18_RS00755 (118643) | 118643..119113 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| LPT18_RS00760 (119272) | 119272..119871 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| LPT18_RS00765 (119896) | 119896..120048 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| LPT18_RS00770 (120591) | 120591..120986 | + | 396 | WP_000901018.1 | hypothetical protein | - |
| LPT18_RS00775 (121182) | 121182..122567 | + | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
| LPT18_RS00780 (123022) | 123022..123843 | - | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T249026 WP_000031108.1 NZ_CP099508:119896-120048 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT249026 WP_001251224.1 NZ_CP099508:119272-119871 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|