Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1733780..1734309 | Replicon | chromosome |
Accession | NZ_CP099506 | ||
Organism | Staphylococcus aureus strain 0316-H-5A |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | LPT22_RS08665 | Protein ID | WP_000621175.1 |
Coordinates | 1733780..1734142 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | LPT22_RS08670 | Protein ID | WP_000948331.1 |
Coordinates | 1734139..1734309 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT22_RS08645 (1730758) | 1730758..1731528 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
LPT22_RS08650 (1731503) | 1731503..1731982 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
LPT22_RS08655 (1731984) | 1731984..1732310 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
LPT22_RS08660 (1732429) | 1732429..1733430 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
LPT22_RS08665 (1733780) | 1733780..1734142 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
LPT22_RS08670 (1734139) | 1734139..1734309 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LPT22_RS08675 (1734394) | 1734394..1735542 | - | 1149 | WP_001281139.1 | alanine racemase | - |
LPT22_RS08680 (1735608) | 1735608..1735967 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
LPT22_RS08685 (1735971) | 1735971..1736462 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
LPT22_RS08690 (1736455) | 1736455..1738032 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
LPT22_RS08695 (1738025) | 1738025..1738504 | - | 480 | WP_001287081.1 | hypothetical protein | - |
LPT22_RS08700 (1738713) | 1738713..1739273 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T249016 WP_000621175.1 NZ_CP099506:c1734142-1733780 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|