Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1598983..1599771 Replicon chromosome
Accession NZ_CP099506
Organism Staphylococcus aureus strain 0316-H-5A

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag LPT22_RS08000 Protein ID WP_000525004.1
Coordinates 1599310..1599771 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag LPT22_RS07995 Protein ID WP_000333630.1
Coordinates 1598983..1599297 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT22_RS07940 (1594588) 1594588..1595016 - 429 WP_031886357.1 single-stranded DNA-binding protein -
LPT22_RS07945 (1595016) 1595016..1595639 - 624 WP_000139720.1 DUF1071 domain-containing protein -
LPT22_RS07950 (1595632) 1595632..1595853 - 222 WP_000815401.1 DUF2483 family protein -
LPT22_RS07955 (1595863) 1595863..1596123 - 261 WP_031886358.1 DUF1108 family protein -
LPT22_RS07960 (1596128) 1596128..1596430 - 303 WP_000165363.1 DUF2482 family protein -
LPT22_RS07965 (1596523) 1596523..1596684 - 162 WP_000066017.1 DUF1270 domain-containing protein -
LPT22_RS07970 (1596677) 1596677..1596898 - 222 WP_000594790.1 hypothetical protein -
LPT22_RS07975 (1596970) 1596970..1597623 + 654 WP_031886359.1 hypothetical protein -
LPT22_RS07980 (1597633) 1597633..1597776 - 144 WP_000939498.1 hypothetical protein -
LPT22_RS07985 (1597805) 1597805..1598581 - 777 WP_001148544.1 Rha family transcriptional regulator -
LPT22_RS07990 (1598595) 1598595..1598831 - 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
LPT22_RS07995 (1598983) 1598983..1599297 + 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
LPT22_RS08000 (1599310) 1599310..1599771 + 462 WP_000525004.1 hypothetical protein Toxin
LPT22_RS08005 (1599790) 1599790..1600293 + 504 WP_031886360.1 hypothetical protein -
LPT22_RS08010 (1600355) 1600355..1601401 + 1047 WP_031886361.1 tyrosine-type recombinase/integrase -
LPT22_RS08015 (1601446) 1601446..1602591 + 1146 WP_031872285.1 radical SAM/CxCxxxxC motif protein YfkAB -
LPT22_RS08020 (1602853) 1602853..1603383 - 531 WP_000184383.1 acyl-CoA thioesterase -
LPT22_RS08025 (1603473) 1603473..1604729 - 1257 WP_001793428.1 aminopeptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1562899..1601401 38502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T249015 WP_000525004.1 NZ_CP099506:1599310-1599771 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT249015 WP_000333630.1 NZ_CP099506:1598983-1599297 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References