Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1532764..1533540 | Replicon | chromosome |
Accession | NZ_CP099506 | ||
Organism | Staphylococcus aureus strain 0316-H-5A |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | LPT22_RS07420 | Protein ID | WP_000031108.1 |
Coordinates | 1532764..1532916 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | LPT22_RS07425 | Protein ID | WP_001251224.1 |
Coordinates | 1532941..1533540 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT22_RS07405 (1528969) | 1528969..1529790 | + | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
LPT22_RS07410 (1530245) | 1530245..1531630 | - | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
LPT22_RS07415 (1531826) | 1531826..1532221 | - | 396 | WP_000901018.1 | hypothetical protein | - |
LPT22_RS07420 (1532764) | 1532764..1532916 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
LPT22_RS07425 (1532941) | 1532941..1533540 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
LPT22_RS07430 (1533699) | 1533699..1534169 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
LPT22_RS07435 (1534174) | 1534174..1535301 | - | 1128 | WP_229360502.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
LPT22_RS07440 (1535452) | 1535452..1536174 | - | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
LPT22_RS07445 (1536167) | 1536167..1537624 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T249011 WP_000031108.1 NZ_CP099506:c1532916-1532764 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT249011 WP_001251224.1 NZ_CP099506:c1533540-1532941 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|