Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 517737..518213 Replicon chromosome
Accession NZ_CP099506
Organism Staphylococcus aureus strain 0316-H-5A

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LPT22_RS02560 Protein ID WP_000052076.1
Coordinates 517737..517925 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LPT22_RS02565 Protein ID WP_001059690.1
Coordinates 517953..518213 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT22_RS02530 (513766) 513766..514248 + 483 WP_031886402.1 hypothetical protein -
LPT22_RS02535 (514589) 514589..515275 + 687 WP_001574556.1 thermonuclease family protein -
LPT22_RS02540 (515632) 515632..515832 + 201 WP_001059082.1 cold-shock protein -
LPT22_RS02545 (516329) 516329..516547 - 219 WP_000005881.1 hypothetical protein -
LPT22_RS02550 (516608) 516608..516892 - 285 WP_001004403.1 hypothetical protein -
LPT22_RS02555 (516980) 516980..517549 - 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
LPT22_RS02560 (517737) 517737..517925 - 189 WP_000052076.1 hypothetical protein Toxin
LPT22_RS02565 (517953) 517953..518213 - 261 WP_001059690.1 hypothetical protein Antitoxin
LPT22_RS02570 (518555) 518555..518758 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LPT22_RS02575 (518755) 518755..518991 - 237 WP_000368687.1 hypothetical protein -
LPT22_RS02580 (519216) 519216..519797 + 582 WP_001140696.1 histidine phosphatase family protein -
LPT22_RS02585 (519870) 519870..520487 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
LPT22_RS02590 (520636) 520636..521130 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
LPT22_RS02595 (521529) 521529..521951 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
LPT22_RS02600 (522099) 522099..522815 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T249010 WP_000052076.1 NZ_CP099506:c517925-517737 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT249010 WP_001059690.1 NZ_CP099506:c518213-517953 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References