Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2469570..2470358 Replicon chromosome
Accession NZ_CP099504
Organism Staphylococcus aureus strain S36

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag LPT20_RS12065 Protein ID WP_000525004.1
Coordinates 2469570..2470031 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag LPT20_RS12070 Protein ID WP_000333630.1
Coordinates 2470044..2470358 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT20_RS12010 (LPT20_12010) 2466094..2466648 + 555 WP_000132890.1 alpha/beta hydrolase -
LPT20_RS12055 (LPT20_12055) 2467926..2468975 - 1050 WP_000146088.1 site-specific integrase -
LPT20_RS12060 (LPT20_12060) 2469037..2469552 - 516 WP_138271955.1 hypothetical protein -
LPT20_RS12065 (LPT20_12065) 2469570..2470031 - 462 WP_000525004.1 hypothetical protein Toxin
LPT20_RS12070 (LPT20_12070) 2470044..2470358 - 315 WP_000333630.1 helix-turn-helix transcriptional regulator Antitoxin
LPT20_RS12075 (LPT20_12075) 2470510..2470746 + 237 WP_001121027.1 helix-turn-helix transcriptional regulator -
LPT20_RS12080 (LPT20_12080) 2470760..2471536 + 777 WP_031783556.1 Rha family transcriptional regulator -
LPT20_RS12085 (LPT20_12085) 2471565..2471732 + 168 WP_162852001.1 hypothetical protein -
LPT20_RS12090 (LPT20_12090) 2471783..2472265 - 483 WP_033858402.1 hypothetical protein -
LPT20_RS12095 (LPT20_12095) 2472325..2473038 + 714 WP_054249650.1 BRO family protein -
LPT20_RS12100 (LPT20_12100) 2473051..2473260 + 210 WP_000455727.1 hypothetical protein -
LPT20_RS12105 (LPT20_12105) 2473274..2473435 + 162 WP_000048124.1 DUF1270 family protein -
LPT20_RS12110 (LPT20_12110) 2473524..2473841 + 318 WP_000829613.1 hypothetical protein -
LPT20_RS12115 (LPT20_12115) 2473846..2474106 + 261 WP_001556704.1 DUF1108 family protein -
LPT20_RS12120 (LPT20_12120) 2474119..2474655 + 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
LPT20_RS12125 (LPT20_12125) 2474656..2475306 + 651 WP_000840496.1 ERF family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - chp / scn / hysA 2466094..2530711 64617


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T249008 WP_000525004.1 NZ_CP099504:c2470031-2469570 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT249008 WP_000333630.1 NZ_CP099504:c2470358-2470044 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References