Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2469570..2470358 | Replicon | chromosome |
| Accession | NZ_CP099504 | ||
| Organism | Staphylococcus aureus strain S36 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | LPT20_RS12065 | Protein ID | WP_000525004.1 |
| Coordinates | 2469570..2470031 (-) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | LPT20_RS12070 | Protein ID | WP_000333630.1 |
| Coordinates | 2470044..2470358 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT20_RS12010 (LPT20_12010) | 2466094..2466648 | + | 555 | WP_000132890.1 | alpha/beta hydrolase | - |
| LPT20_RS12055 (LPT20_12055) | 2467926..2468975 | - | 1050 | WP_000146088.1 | site-specific integrase | - |
| LPT20_RS12060 (LPT20_12060) | 2469037..2469552 | - | 516 | WP_138271955.1 | hypothetical protein | - |
| LPT20_RS12065 (LPT20_12065) | 2469570..2470031 | - | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| LPT20_RS12070 (LPT20_12070) | 2470044..2470358 | - | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LPT20_RS12075 (LPT20_12075) | 2470510..2470746 | + | 237 | WP_001121027.1 | helix-turn-helix transcriptional regulator | - |
| LPT20_RS12080 (LPT20_12080) | 2470760..2471536 | + | 777 | WP_031783556.1 | Rha family transcriptional regulator | - |
| LPT20_RS12085 (LPT20_12085) | 2471565..2471732 | + | 168 | WP_162852001.1 | hypothetical protein | - |
| LPT20_RS12090 (LPT20_12090) | 2471783..2472265 | - | 483 | WP_033858402.1 | hypothetical protein | - |
| LPT20_RS12095 (LPT20_12095) | 2472325..2473038 | + | 714 | WP_054249650.1 | BRO family protein | - |
| LPT20_RS12100 (LPT20_12100) | 2473051..2473260 | + | 210 | WP_000455727.1 | hypothetical protein | - |
| LPT20_RS12105 (LPT20_12105) | 2473274..2473435 | + | 162 | WP_000048124.1 | DUF1270 family protein | - |
| LPT20_RS12110 (LPT20_12110) | 2473524..2473841 | + | 318 | WP_000829613.1 | hypothetical protein | - |
| LPT20_RS12115 (LPT20_12115) | 2473846..2474106 | + | 261 | WP_001556704.1 | DUF1108 family protein | - |
| LPT20_RS12120 (LPT20_12120) | 2474119..2474655 | + | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| LPT20_RS12125 (LPT20_12125) | 2474656..2475306 | + | 651 | WP_000840496.1 | ERF family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | chp / scn / hysA | 2466094..2530711 | 64617 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T249008 WP_000525004.1 NZ_CP099504:c2470031-2469570 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |