Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2288696..2289225 | Replicon | chromosome |
Accession | NZ_CP099504 | ||
Organism | Staphylococcus aureus strain S36 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | LPT20_RS11015 | Protein ID | WP_000621175.1 |
Coordinates | 2288863..2289225 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | LPT20_RS11010 | Protein ID | WP_000948331.1 |
Coordinates | 2288696..2288866 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT20_RS10980 (LPT20_10980) | 2283732..2284292 | + | 561 | WP_001092405.1 | K(+)-transporting ATPase subunit C | - |
LPT20_RS10985 (LPT20_10985) | 2284501..2284980 | + | 480 | WP_001287083.1 | hypothetical protein | - |
LPT20_RS10990 (LPT20_10990) | 2284973..2286556 | + | 1584 | WP_001294642.1 | PH domain-containing protein | - |
LPT20_RS10995 (LPT20_10995) | 2286543..2287034 | + | 492 | WP_001205915.1 | PH domain-containing protein | - |
LPT20_RS11000 (LPT20_11000) | 2287038..2287397 | + | 360 | WP_000581194.1 | holo-ACP synthase | - |
LPT20_RS11005 (LPT20_11005) | 2287463..2288611 | + | 1149 | WP_001280702.1 | alanine racemase | - |
LPT20_RS11010 (LPT20_11010) | 2288696..2288866 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LPT20_RS11015 (LPT20_11015) | 2288863..2289225 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
LPT20_RS11020 (LPT20_11020) | 2289574..2290575 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
LPT20_RS11025 (LPT20_11025) | 2290694..2291020 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
LPT20_RS11030 (LPT20_11030) | 2291022..2291501 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
LPT20_RS11035 (LPT20_11035) | 2291476..2292246 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T249006 WP_000621175.1 NZ_CP099504:2288863-2289225 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|