Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 1723649..1724757 | Replicon | chromosome |
Accession | NZ_CP099504 | ||
Organism | Staphylococcus aureus strain S36 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | R3JIN1 |
Locus tag | LPT20_RS08155 | Protein ID | WP_000233000.1 |
Coordinates | 1723888..1724757 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | LPT20_RS08150 | Protein ID | WP_000205227.1 |
Coordinates | 1723649..1723873 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT20_RS08120 (LPT20_08120) | 1719238..1719408 | + | 171 | WP_000713595.1 | hypothetical protein | - |
LPT20_RS08125 (LPT20_08125) | 1719422..1720040 | + | 619 | Protein_1599 | recombinase family protein | - |
LPT20_RS08130 (LPT20_08130) | 1720040..1720717 | + | 678 | Protein_1600 | DNA topoisomerase | - |
LPT20_RS08135 (LPT20_08135) | 1721199..1721525 | + | 327 | WP_000392725.1 | hypothetical protein | - |
LPT20_RS08140 (LPT20_08140) | 1721526..1721942 | + | 417 | WP_000323438.1 | recombinase | - |
LPT20_RS08145 (LPT20_08145) | 1721962..1723506 | + | 1545 | WP_002390960.1 | recombinase family protein | - |
LPT20_RS08150 (LPT20_08150) | 1723649..1723873 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
LPT20_RS08155 (LPT20_08155) | 1723888..1724757 | + | 870 | WP_000233000.1 | nucleotidyltransferase domain-containing protein | Toxin |
LPT20_RS08160 (LPT20_08160) | 1724738..1725472 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
LPT20_RS08165 (LPT20_08165) | 1725505..1726413 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
LPT20_RS08170 (LPT20_08170) | 1726410..1726890 | + | 481 | Protein_1608 | GNAT family N-acetyltransferase | - |
LPT20_RS08175 (LPT20_08175) | 1726983..1727777 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
LPT20_RS14400 | 1728187..1728270 | + | 84 | Protein_1610 | MLS leader peptide | - |
LPT20_RS08180 (LPT20_08180) | 1728319..1728402 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
LPT20_RS08185 (LPT20_08185) | 1728527..1729264 | + | 738 | WP_001038790.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | cat(pC233) / ant(6)-Ia / aph(3')-III / erm(B) | - | 1710985..1734180 | 23195 | |
- | flank | IS/Tn | ant(6)-Ia / aph(3')-III / erm(B) | - | 1725505..1734180 | 8675 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32926.57 Da Isoelectric Point: 4.8781
>T248999 WP_000233000.1 NZ_CP099504:1723888-1724757 [Staphylococcus aureus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|