Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 707675..708152 Replicon chromosome
Accession NZ_CP099504
Organism Staphylococcus aureus strain S36

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LPT20_RS03385 Protein ID WP_000052076.1
Coordinates 707964..708152 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LPT20_RS03380 Protein ID WP_001059690.1
Coordinates 707675..707935 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT20_RS03345 (LPT20_03345) 703067..703783 - 717 WP_000150029.1 type I 3-dehydroquinate dehydratase -
LPT20_RS03350 (LPT20_03350) 703931..704353 + 423 WP_000974455.1 organic hydroperoxide resistance protein -
LPT20_RS03355 (LPT20_03355) 704752..705246 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
LPT20_RS03360 (LPT20_03360) 705402..706019 + 618 WP_000255554.1 LysE/ArgO family amino acid transporter -
LPT20_RS03365 (LPT20_03365) 706092..706673 - 582 WP_001140697.1 histidine phosphatase family protein -
LPT20_RS03370 (LPT20_03370) 706898..707134 + 237 WP_000368687.1 hypothetical protein -
LPT20_RS03375 (LPT20_03375) 707131..707334 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LPT20_RS03380 (LPT20_03380) 707675..707935 + 261 WP_001059690.1 hypothetical protein Antitoxin
LPT20_RS03385 (LPT20_03385) 707964..708152 + 189 WP_000052076.1 hypothetical protein Toxin
LPT20_RS03390 (LPT20_03390) 708340..708909 + 570 WP_001106657.1 lipoprotein N-acylation protein LnsA -
LPT20_RS03395 (LPT20_03395) 708997..709281 + 285 WP_001004397.1 hypothetical protein -
LPT20_RS03400 (LPT20_03400) 709343..709561 + 219 WP_000005888.1 hypothetical protein -
LPT20_RS03405 (LPT20_03405) 710060..710260 - 201 WP_001059082.1 cold-shock protein -
LPT20_RS03410 (LPT20_03410) 710617..711303 - 687 WP_001823812.1 thermonuclease family protein -
LPT20_RS03415 (LPT20_03415) 711644..712114 - 471 WP_000824462.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - seb / selq / selk / vWbp 680125..726095 45970


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T248998 WP_000052076.1 NZ_CP099504:707964-708152 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT248998 WP_001059690.1 NZ_CP099504:707675-707935 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References