Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 689925..690457 Replicon chromosome
Accession NZ_CP099504
Organism Staphylococcus aureus strain S36

Toxin (Protein)


Gene name TscT Uniprot ID Q93CD4
Locus tag LPT20_RS03240 Protein ID WP_001103942.1
Coordinates 689925..690245 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag LPT20_RS03245 Protein ID WP_001058486.1
Coordinates 690248..690457 (-) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT20_RS03210 (LPT20_03210) 685076..685417 - 342 WP_001190615.1 hypothetical protein -
LPT20_RS03215 (LPT20_03215) 685934..686575 - 642 WP_001019764.1 hypothetical protein -
LPT20_RS03220 (LPT20_03220) 686572..686856 - 285 WP_000998181.1 hypothetical protein -
LPT20_RS03225 (LPT20_03225) 686858..687220 - 363 WP_001039168.1 hypothetical protein -
LPT20_RS03230 (LPT20_03230) 687512..688975 - 1464 WP_229359989.1 virulence-associated E family protein -
LPT20_RS03235 (LPT20_03235) 688992..689861 - 870 WP_001002732.1 primase alpha helix C-terminal domain-containing protein -
LPT20_RS03240 (LPT20_03240) 689925..690245 - 321 WP_001103942.1 DUF1474 family protein Toxin
LPT20_RS03245 (LPT20_03245) 690248..690457 - 210 WP_001058486.1 hypothetical protein Antitoxin
LPT20_RS03250 (LPT20_03250) 690450..690596 - 147 WP_000784875.1 hypothetical protein -
LPT20_RS03255 (LPT20_03255) 690608..690880 - 273 WP_000091731.1 helix-turn-helix domain-containing protein -
LPT20_RS03260 (LPT20_03260) 690873..691136 - 264 WP_000243851.1 helix-turn-helix transcriptional regulator -
LPT20_RS03265 (LPT20_03265) 691329..691661 + 333 WP_001260004.1 helix-turn-helix transcriptional regulator -
LPT20_RS03270 (LPT20_03270) 691673..692131 + 459 WP_000281657.1 ImmA/IrrE family metallo-endopeptidase -
LPT20_RS03275 (LPT20_03275) 692148..692579 + 432 WP_001228759.1 hypothetical protein -
LPT20_RS03280 (LPT20_03280) 692649..693377 + 729 WP_001033318.1 staphylococcal enterotoxin type Q -
LPT20_RS03285 (LPT20_03285) 693401..694129 + 729 WP_000733774.1 staphylococcal enterotoxin type K -
LPT20_RS03290 (LPT20_03290) 694217..695437 + 1221 WP_000266157.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - seb / selq / selk / vWbp 680125..726095 45970


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 12694.22 Da        Isoelectric Point: 4.7419

>T248997 WP_001103942.1 NZ_CP099504:c690245-689925 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE

Download         Length: 321 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8252.31 Da        Isoelectric Point: 4.3718

>AT248997 WP_001058486.1 NZ_CP099504:c690457-690248 [Staphylococcus aureus]
MNNEQKEVIEHLVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q93CD4

Antitoxin

Source ID Structure

References