Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 689925..690457 | Replicon | chromosome |
| Accession | NZ_CP099504 | ||
| Organism | Staphylococcus aureus strain S36 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | Q93CD4 |
| Locus tag | LPT20_RS03240 | Protein ID | WP_001103942.1 |
| Coordinates | 689925..690245 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | - |
| Locus tag | LPT20_RS03245 | Protein ID | WP_001058486.1 |
| Coordinates | 690248..690457 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT20_RS03210 (LPT20_03210) | 685076..685417 | - | 342 | WP_001190615.1 | hypothetical protein | - |
| LPT20_RS03215 (LPT20_03215) | 685934..686575 | - | 642 | WP_001019764.1 | hypothetical protein | - |
| LPT20_RS03220 (LPT20_03220) | 686572..686856 | - | 285 | WP_000998181.1 | hypothetical protein | - |
| LPT20_RS03225 (LPT20_03225) | 686858..687220 | - | 363 | WP_001039168.1 | hypothetical protein | - |
| LPT20_RS03230 (LPT20_03230) | 687512..688975 | - | 1464 | WP_229359989.1 | virulence-associated E family protein | - |
| LPT20_RS03235 (LPT20_03235) | 688992..689861 | - | 870 | WP_001002732.1 | primase alpha helix C-terminal domain-containing protein | - |
| LPT20_RS03240 (LPT20_03240) | 689925..690245 | - | 321 | WP_001103942.1 | DUF1474 family protein | Toxin |
| LPT20_RS03245 (LPT20_03245) | 690248..690457 | - | 210 | WP_001058486.1 | hypothetical protein | Antitoxin |
| LPT20_RS03250 (LPT20_03250) | 690450..690596 | - | 147 | WP_000784875.1 | hypothetical protein | - |
| LPT20_RS03255 (LPT20_03255) | 690608..690880 | - | 273 | WP_000091731.1 | helix-turn-helix domain-containing protein | - |
| LPT20_RS03260 (LPT20_03260) | 690873..691136 | - | 264 | WP_000243851.1 | helix-turn-helix transcriptional regulator | - |
| LPT20_RS03265 (LPT20_03265) | 691329..691661 | + | 333 | WP_001260004.1 | helix-turn-helix transcriptional regulator | - |
| LPT20_RS03270 (LPT20_03270) | 691673..692131 | + | 459 | WP_000281657.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LPT20_RS03275 (LPT20_03275) | 692148..692579 | + | 432 | WP_001228759.1 | hypothetical protein | - |
| LPT20_RS03280 (LPT20_03280) | 692649..693377 | + | 729 | WP_001033318.1 | staphylococcal enterotoxin type Q | - |
| LPT20_RS03285 (LPT20_03285) | 693401..694129 | + | 729 | WP_000733774.1 | staphylococcal enterotoxin type K | - |
| LPT20_RS03290 (LPT20_03290) | 694217..695437 | + | 1221 | WP_000266157.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | seb / selq / selk / vWbp | 680125..726095 | 45970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12694.22 Da Isoelectric Point: 4.7419
>T248997 WP_001103942.1 NZ_CP099504:c690245-689925 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFSELIQKF
HEIEKASSENFDEESDDAKNSIKVAE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|