Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2614242..2614771 | Replicon | chromosome |
| Accession | NZ_CP099502 | ||
| Organism | Staphylococcus aureus strain JL42 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LPT17_RS12800 | Protein ID | WP_000621175.1 |
| Coordinates | 2614409..2614771 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | LPT17_RS12795 | Protein ID | WP_000948331.1 |
| Coordinates | 2614242..2614412 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT17_RS12765 (2609278) | 2609278..2609838 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
| LPT17_RS12770 (2610047) | 2610047..2610526 | + | 480 | WP_001287081.1 | hypothetical protein | - |
| LPT17_RS12775 (2610519) | 2610519..2612096 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| LPT17_RS12780 (2612089) | 2612089..2612580 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
| LPT17_RS12785 (2612584) | 2612584..2612943 | + | 360 | WP_096002285.1 | holo-ACP synthase | - |
| LPT17_RS12790 (2613009) | 2613009..2614157 | + | 1149 | WP_001281139.1 | alanine racemase | - |
| LPT17_RS12795 (2614242) | 2614242..2614412 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| LPT17_RS12800 (2614409) | 2614409..2614771 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LPT17_RS12805 (2615120) | 2615120..2616121 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| LPT17_RS12810 (2616240) | 2616240..2616566 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| LPT17_RS12815 (2616568) | 2616568..2617047 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| LPT17_RS12820 (2617022) | 2617022..2617792 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T248996 WP_000621175.1 NZ_CP099502:2614409-2614771 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|