Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1124883..1125359 Replicon chromosome
Accession NZ_CP099502
Organism Staphylococcus aureus strain JL42

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LPT17_RS05585 Protein ID WP_000052076.1
Coordinates 1125171..1125359 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LPT17_RS05580 Protein ID WP_001059690.1
Coordinates 1124883..1125143 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT17_RS05545 (1120281) 1120281..1120997 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
LPT17_RS05550 (1121145) 1121145..1121567 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
LPT17_RS05555 (1121966) 1121966..1122460 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
LPT17_RS05560 (1122609) 1122609..1123226 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
LPT17_RS05565 (1123299) 1123299..1123880 - 582 WP_001140696.1 histidine phosphatase family protein -
LPT17_RS05570 (1124105) 1124105..1124341 + 237 WP_000368687.1 hypothetical protein -
LPT17_RS05575 (1124338) 1124338..1124541 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LPT17_RS05580 (1124883) 1124883..1125143 + 261 WP_001059690.1 hypothetical protein Antitoxin
LPT17_RS05585 (1125171) 1125171..1125359 + 189 WP_000052076.1 hypothetical protein Toxin
LPT17_RS05590 (1125547) 1125547..1126116 + 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
LPT17_RS05595 (1126204) 1126204..1126488 + 285 WP_001004403.1 hypothetical protein -
LPT17_RS05600 (1126549) 1126549..1126767 + 219 WP_000005881.1 hypothetical protein -
LPT17_RS05605 (1127264) 1127264..1127464 - 201 WP_001059082.1 cold-shock protein -
LPT17_RS05610 (1127821) 1127821..1128507 - 687 WP_001574556.1 thermonuclease family protein -
LPT17_RS05615 (1128848) 1128848..1129330 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T248990 WP_000052076.1 NZ_CP099502:1125171-1125359 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT248990 WP_001059690.1 NZ_CP099502:1124883-1125143 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References