Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 119271..120047 | Replicon | chromosome |
| Accession | NZ_CP099502 | ||
| Organism | Staphylococcus aureus strain JL42 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | LPT17_RS00765 | Protein ID | WP_000031108.1 |
| Coordinates | 119895..120047 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | LPT17_RS00760 | Protein ID | WP_001251224.1 |
| Coordinates | 119271..119870 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT17_RS00740 (115187) | 115187..116644 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
| LPT17_RS00745 (116637) | 116637..117359 | + | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
| LPT17_RS00750 (117510) | 117510..118637 | + | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| LPT17_RS00755 (118642) | 118642..119112 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| LPT17_RS00760 (119271) | 119271..119870 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| LPT17_RS00765 (119895) | 119895..120047 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| LPT17_RS00770 (120590) | 120590..120985 | + | 396 | WP_000901018.1 | hypothetical protein | - |
| LPT17_RS00775 (121181) | 121181..122566 | + | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
| LPT17_RS00780 (123021) | 123021..123842 | - | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T248989 WP_000031108.1 NZ_CP099502:119895-120047 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT248989 WP_001251224.1 NZ_CP099502:119271-119870 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|