Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1528504..1529280 | Replicon | chromosome |
Accession | NZ_CP099499 | ||
Organism | Staphylococcus aureus strain 0610-H-2A |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | LPT19_RS07400 | Protein ID | WP_000031108.1 |
Coordinates | 1528504..1528656 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | LPT19_RS07405 | Protein ID | WP_001251224.1 |
Coordinates | 1528681..1529280 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT19_RS07385 (LPT19_07385) | 1524709..1525530 | + | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
LPT19_RS07390 (LPT19_07390) | 1525985..1527370 | - | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
LPT19_RS07395 (LPT19_07395) | 1527566..1527961 | - | 396 | WP_000901018.1 | hypothetical protein | - |
LPT19_RS07400 (LPT19_07400) | 1528504..1528656 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
LPT19_RS07405 (LPT19_07405) | 1528681..1529280 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
LPT19_RS07410 (LPT19_07410) | 1529439..1529909 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
LPT19_RS07415 (LPT19_07415) | 1529914..1531041 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
LPT19_RS07420 (LPT19_07420) | 1531192..1531914 | - | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
LPT19_RS07425 (LPT19_07425) | 1531907..1533364 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T248978 WP_000031108.1 NZ_CP099499:c1528656-1528504 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT248978 WP_001251224.1 NZ_CP099499:c1529280-1528681 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|