Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 513968..514444 Replicon chromosome
Accession NZ_CP099499
Organism Staphylococcus aureus strain 0610-H-2A

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LPT19_RS02560 Protein ID WP_000052076.1
Coordinates 513968..514156 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LPT19_RS02565 Protein ID WP_001059690.1
Coordinates 514184..514444 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT19_RS02530 (LPT19_02530) 509997..510479 + 483 WP_031886402.1 hypothetical protein -
LPT19_RS02535 (LPT19_02535) 510820..511506 + 687 WP_001574556.1 thermonuclease family protein -
LPT19_RS02540 (LPT19_02540) 511863..512063 + 201 WP_001059082.1 cold-shock protein -
LPT19_RS02545 (LPT19_02545) 512560..512778 - 219 WP_000005881.1 hypothetical protein -
LPT19_RS02550 (LPT19_02550) 512839..513123 - 285 WP_001004403.1 hypothetical protein -
LPT19_RS02555 (LPT19_02555) 513211..513780 - 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
LPT19_RS02560 (LPT19_02560) 513968..514156 - 189 WP_000052076.1 hypothetical protein Toxin
LPT19_RS02565 (LPT19_02565) 514184..514444 - 261 WP_001059690.1 hypothetical protein Antitoxin
LPT19_RS02570 (LPT19_02570) 514786..514989 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LPT19_RS02575 (LPT19_02575) 514986..515222 - 237 WP_000368687.1 hypothetical protein -
LPT19_RS02580 (LPT19_02580) 515447..516028 + 582 WP_001140696.1 histidine phosphatase family protein -
LPT19_RS02585 (LPT19_02585) 516101..516718 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
LPT19_RS02590 (LPT19_02590) 516867..517361 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
LPT19_RS02595 (LPT19_02595) 517760..518182 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
LPT19_RS02600 (LPT19_02600) 518330..519046 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T248977 WP_000052076.1 NZ_CP099499:c514156-513968 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT248977 WP_001059690.1 NZ_CP099499:c514444-514184 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References