Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1696265..1696794 | Replicon | chromosome |
Accession | NZ_CP099497 | ||
Organism | Staphylococcus aureus strain 0213-M-4A |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | LPT21_RS08325 | Protein ID | WP_000621175.1 |
Coordinates | 1696265..1696627 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | LPT21_RS08330 | Protein ID | WP_000948331.1 |
Coordinates | 1696624..1696794 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT21_RS08305 (LPT21_08305) | 1693243..1694013 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
LPT21_RS08310 (LPT21_08310) | 1693988..1694467 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
LPT21_RS08315 (LPT21_08315) | 1694469..1694795 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
LPT21_RS08320 (LPT21_08320) | 1694914..1695915 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
LPT21_RS08325 (LPT21_08325) | 1696265..1696627 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
LPT21_RS08330 (LPT21_08330) | 1696624..1696794 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LPT21_RS08335 (LPT21_08335) | 1696879..1698027 | - | 1149 | WP_001281139.1 | alanine racemase | - |
LPT21_RS08340 (LPT21_08340) | 1698093..1698452 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
LPT21_RS08345 (LPT21_08345) | 1698456..1698947 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
LPT21_RS08350 (LPT21_08350) | 1698940..1700517 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
LPT21_RS08355 (LPT21_08355) | 1700510..1700989 | - | 480 | WP_001287081.1 | hypothetical protein | - |
LPT21_RS08360 (LPT21_08360) | 1701198..1701758 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T248970 WP_000621175.1 NZ_CP099497:c1696627-1696265 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|