Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1534634..1535410 | Replicon | chromosome |
Accession | NZ_CP099497 | ||
Organism | Staphylococcus aureus strain 0213-M-4A |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | LPT21_RS07405 | Protein ID | WP_000031108.1 |
Coordinates | 1534634..1534786 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | LPT21_RS07410 | Protein ID | WP_001251224.1 |
Coordinates | 1534811..1535410 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LPT21_RS07390 (LPT21_07390) | 1530839..1531660 | + | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
LPT21_RS07395 (LPT21_07395) | 1532115..1533500 | - | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
LPT21_RS07400 (LPT21_07400) | 1533696..1534091 | - | 396 | WP_000901018.1 | hypothetical protein | - |
LPT21_RS07405 (LPT21_07405) | 1534634..1534786 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
LPT21_RS07410 (LPT21_07410) | 1534811..1535410 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
LPT21_RS07415 (LPT21_07415) | 1535569..1536039 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
LPT21_RS07420 (LPT21_07420) | 1536044..1537171 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
LPT21_RS07425 (LPT21_07425) | 1537322..1538044 | - | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
LPT21_RS07430 (LPT21_07430) | 1538037..1539494 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T248969 WP_000031108.1 NZ_CP099497:c1534786-1534634 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT248969 WP_001251224.1 NZ_CP099497:c1535410-1534811 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|