Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 522121..522597 Replicon chromosome
Accession NZ_CP099497
Organism Staphylococcus aureus strain 0213-M-4A

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LPT21_RS02570 Protein ID WP_000052076.1
Coordinates 522121..522309 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LPT21_RS02575 Protein ID WP_001059690.1
Coordinates 522337..522597 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LPT21_RS02540 (LPT21_02540) 518150..518632 + 483 WP_031886402.1 hypothetical protein -
LPT21_RS02545 (LPT21_02545) 518973..519659 + 687 WP_001574556.1 thermonuclease family protein -
LPT21_RS02550 (LPT21_02550) 520016..520216 + 201 WP_001059082.1 cold-shock protein -
LPT21_RS02555 (LPT21_02555) 520713..520931 - 219 WP_000005881.1 hypothetical protein -
LPT21_RS02560 (LPT21_02560) 520992..521276 - 285 WP_001004403.1 hypothetical protein -
LPT21_RS02565 (LPT21_02565) 521364..521933 - 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
LPT21_RS02570 (LPT21_02570) 522121..522309 - 189 WP_000052076.1 hypothetical protein Toxin
LPT21_RS02575 (LPT21_02575) 522337..522597 - 261 WP_001059690.1 hypothetical protein Antitoxin
LPT21_RS02580 (LPT21_02580) 522939..523142 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LPT21_RS02585 (LPT21_02585) 523139..523375 - 237 WP_000368687.1 hypothetical protein -
LPT21_RS02590 (LPT21_02590) 523600..524181 + 582 WP_001140696.1 histidine phosphatase family protein -
LPT21_RS02595 (LPT21_02595) 524254..524871 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
LPT21_RS02600 (LPT21_02600) 525020..525514 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
LPT21_RS02605 (LPT21_02605) 525913..526335 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
LPT21_RS02610 (LPT21_02610) 526483..527199 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T248968 WP_000052076.1 NZ_CP099497:c522309-522121 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT248968 WP_001059690.1 NZ_CP099497:c522597-522337 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References