Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2638197..2638726 | Replicon | chromosome |
| Accession | NZ_CP099495 | ||
| Organism | Staphylococcus aureus strain JL28 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LPT16_RS12905 | Protein ID | WP_000621175.1 |
| Coordinates | 2638364..2638726 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | LPT16_RS12900 | Protein ID | WP_000948331.1 |
| Coordinates | 2638197..2638367 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LPT16_RS12870 (2633233) | 2633233..2633793 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
| LPT16_RS12875 (2634002) | 2634002..2634481 | + | 480 | WP_001287081.1 | hypothetical protein | - |
| LPT16_RS12880 (2634474) | 2634474..2636051 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| LPT16_RS12885 (2636044) | 2636044..2636535 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
| LPT16_RS12890 (2636539) | 2636539..2636898 | + | 360 | WP_096002285.1 | holo-ACP synthase | - |
| LPT16_RS12895 (2636964) | 2636964..2638112 | + | 1149 | WP_001281139.1 | alanine racemase | - |
| LPT16_RS12900 (2638197) | 2638197..2638367 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| LPT16_RS12905 (2638364) | 2638364..2638726 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LPT16_RS12910 (2639076) | 2639076..2640077 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| LPT16_RS12915 (2640196) | 2640196..2640522 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| LPT16_RS12920 (2640524) | 2640524..2641003 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| LPT16_RS12925 (2640978) | 2640978..2641748 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T248967 WP_000621175.1 NZ_CP099495:2638364-2638726 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|