Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2947791..2948401 | Replicon | chromosome |
Accession | NZ_CP099490 | ||
Organism | Ornithinimicrobium cryptoxanthini strain JY.X270 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NF557_RS13570 | Protein ID | WP_252620058.1 |
Coordinates | 2947997..2948401 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NF557_RS13565 | Protein ID | WP_252620057.1 |
Coordinates | 2947791..2948000 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF557_RS13555 (NF557_13555) | 2943343..2944296 | + | 954 | WP_252620055.1 | histone-like nucleoid-structuring protein Lsr2 | - |
NF557_RS13560 (NF557_13560) | 2944381..2947764 | + | 3384 | WP_252620056.1 | DEAD/DEAH box helicase | - |
NF557_RS13565 (NF557_13565) | 2947791..2948000 | + | 210 | WP_252620057.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NF557_RS13570 (NF557_13570) | 2947997..2948401 | + | 405 | WP_252620058.1 | PIN domain nuclease | Toxin |
NF557_RS13575 (NF557_13575) | 2948413..2949594 | - | 1182 | WP_252620059.1 | acyl-CoA dehydrogenase family protein | - |
NF557_RS13580 (NF557_13580) | 2949685..2950857 | - | 1173 | WP_252620060.1 | N(5)-(carboxyethyl)ornithine synthase | - |
NF557_RS17615 | 2950841..2950975 | - | 135 | WP_256842133.1 | hypothetical protein | - |
NF557_RS13585 (NF557_13585) | 2951049..2951819 | - | 771 | WP_252620061.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 6.7089
>T248951 WP_252620058.1 NZ_CP099490:2947997-2948401 [Ornithinimicrobium cryptoxanthini]
VIVDTSVWIEFLRPGRSSAGDHLESLIRRRERLVVPETVLMELLSSTTDETAAARQRRMLESFEIAPLEPVVDSLAAARL
QRQCRRSGEAVRNLGDCLIAAVALRLAIPVLHRDRDFEALRTHCGVETVSLLPA
VIVDTSVWIEFLRPGRSSAGDHLESLIRRRERLVVPETVLMELLSSTTDETAAARQRRMLESFEIAPLEPVVDSLAAARL
QRQCRRSGEAVRNLGDCLIAAVALRLAIPVLHRDRDFEALRTHCGVETVSLLPA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|