Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2857857..2858425 | Replicon | chromosome |
Accession | NZ_CP099490 | ||
Organism | Ornithinimicrobium cryptoxanthini strain JY.X270 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NF557_RS13140 | Protein ID | WP_252619975.1 |
Coordinates | 2857857..2858231 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NF557_RS13145 | Protein ID | WP_252619976.1 |
Coordinates | 2858228..2858425 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF557_RS13130 (NF557_13130) | 2855481..2857211 | + | 1731 | WP_252619973.1 | AMP-binding protein | - |
NF557_RS13135 (NF557_13135) | 2857239..2857814 | - | 576 | WP_252619974.1 | peroxidase-related enzyme | - |
NF557_RS13140 (NF557_13140) | 2857857..2858231 | - | 375 | WP_252619975.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NF557_RS13145 (NF557_13145) | 2858228..2858425 | - | 198 | WP_252619976.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NF557_RS13150 (NF557_13150) | 2858508..2860118 | - | 1611 | WP_252619977.1 | molybdopterin-dependent oxidoreductase | - |
NF557_RS13155 (NF557_13155) | 2860209..2860637 | + | 429 | WP_252619978.1 | protease inhibitor I42 family protein | - |
NF557_RS13160 (NF557_13160) | 2860689..2861987 | + | 1299 | WP_252619979.1 | C1 family peptidase | - |
NF557_RS13165 (NF557_13165) | 2862016..2862783 | - | 768 | WP_252624185.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13371.50 Da Isoelectric Point: 6.4797
>T248949 WP_252619975.1 NZ_CP099490:c2858231-2857857 [Ornithinimicrobium cryptoxanthini]
VILVDTSIWIDHLHTSQPDLVRLLDQDAVGCHPAVVEELALGSIAQRDVVLALLESLHQFPVLGHAELLTLVSGRRLWGR
GLSAVDGHLLGAVALVSGARLWTRDRRLMAACRDAGVACLGERT
VILVDTSIWIDHLHTSQPDLVRLLDQDAVGCHPAVVEELALGSIAQRDVVLALLESLHQFPVLGHAELLTLVSGRRLWGR
GLSAVDGHLLGAVALVSGARLWTRDRRLMAACRDAGVACLGERT
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|