Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2750482..2751270 | Replicon | chromosome |
Accession | NZ_CP099490 | ||
Organism | Ornithinimicrobium cryptoxanthini strain JY.X270 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | NF557_RS12680 | Protein ID | WP_252619891.1 |
Coordinates | 2750767..2751270 (+) | Length | 168 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | NF557_RS12675 | Protein ID | WP_252619889.1 |
Coordinates | 2750482..2750766 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF557_RS12645 (NF557_12645) | 2746026..2746901 | + | 876 | WP_252619877.1 | mechanosensitive ion channel family protein | - |
NF557_RS12650 (NF557_12650) | 2746938..2747549 | + | 612 | WP_252619879.1 | winged helix-turn-helix domain-containing protein | - |
NF557_RS12655 (NF557_12655) | 2747546..2748787 | + | 1242 | WP_252619881.1 | MFS transporter | - |
NF557_RS12660 (NF557_12660) | 2748860..2749216 | + | 357 | WP_252619883.1 | YciI family protein | - |
NF557_RS12665 (NF557_12665) | 2749309..2749704 | + | 396 | WP_252619885.1 | globin | - |
NF557_RS12670 (NF557_12670) | 2749752..2750321 | + | 570 | WP_252619887.1 | GNAT family N-acetyltransferase | - |
NF557_RS12675 (NF557_12675) | 2750482..2750766 | + | 285 | WP_252619889.1 | DUF1778 domain-containing protein | Antitoxin |
NF557_RS12680 (NF557_12680) | 2750767..2751270 | + | 504 | WP_252619891.1 | GNAT family N-acetyltransferase | Toxin |
NF557_RS12685 (NF557_12685) | 2751356..2752531 | + | 1176 | WP_252619893.1 | DUF2786 domain-containing protein | - |
NF557_RS12690 (NF557_12690) | 2752528..2753286 | - | 759 | WP_252619895.1 | TetR/AcrR family transcriptional regulator | - |
NF557_RS12695 (NF557_12695) | 2753346..2754314 | + | 969 | WP_252619896.1 | ATP-binding cassette domain-containing protein | - |
NF557_RS12700 (NF557_12700) | 2754311..2755099 | + | 789 | WP_252619897.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 168 a.a. Molecular weight: 17856.51 Da Isoelectric Point: 9.5214
>T248948 WP_252619891.1 NZ_CP099490:2750767-2751270 [Ornithinimicrobium cryptoxanthini]
VTPLQPRPIRARDDCTAFESGEPSLDGYLRDRALSNHLADLARCYVCTEVASNRVLGYYTLSAVAVSRSALPGRARRNAP
DPVPAVLLGRLAVDRMAQGSGLGRLLVRDAIVSTLAAADRIGVRALLVHALHERAASFYGGLGFATSPTDPLHLYVLLAD
VRRSLPG
VTPLQPRPIRARDDCTAFESGEPSLDGYLRDRALSNHLADLARCYVCTEVASNRVLGYYTLSAVAVSRSALPGRARRNAP
DPVPAVLLGRLAVDRMAQGSGLGRLLVRDAIVSTLAAADRIGVRALLVHALHERAASFYGGLGFATSPTDPLHLYVLLAD
VRRSLPG
Download Length: 504 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|