Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1905183..1905747 | Replicon | chromosome |
Accession | NZ_CP099490 | ||
Organism | Ornithinimicrobium cryptoxanthini strain JY.X270 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NF557_RS08800 | Protein ID | WP_252618828.1 |
Coordinates | 1905400..1905747 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NF557_RS08795 | Protein ID | WP_252618827.1 |
Coordinates | 1905183..1905413 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF557_RS08770 (NF557_08770) | 1900619..1901344 | - | 726 | WP_252618822.1 | response regulator transcription factor | - |
NF557_RS08775 (NF557_08775) | 1901341..1901781 | - | 441 | WP_252618823.1 | ATP-binding protein | - |
NF557_RS08780 (NF557_08780) | 1901699..1903294 | - | 1596 | WP_252618824.1 | hypothetical protein | - |
NF557_RS08785 (NF557_08785) | 1903363..1904088 | - | 726 | WP_252618825.1 | hypothetical protein | - |
NF557_RS08790 (NF557_08790) | 1904265..1905173 | + | 909 | WP_252618826.1 | alpha/beta fold hydrolase | - |
NF557_RS08795 (NF557_08795) | 1905183..1905413 | + | 231 | WP_252618827.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NF557_RS08800 (NF557_08800) | 1905400..1905747 | + | 348 | WP_252618828.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NF557_RS08805 (NF557_08805) | 1906108..1907328 | + | 1221 | WP_252618829.1 | hypothetical protein | - |
NF557_RS08810 (NF557_08810) | 1908010..1908531 | + | 522 | WP_252618830.1 | hypothetical protein | - |
NF557_RS08815 (NF557_08815) | 1908605..1908868 | - | 264 | WP_252618831.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NF557_RS08820 (NF557_08820) | 1908865..1909125 | - | 261 | WP_252618832.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NF557_RS08825 (NF557_08825) | 1909309..1909479 | - | 171 | WP_252624332.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12417.41 Da Isoelectric Point: 8.9932
>T248946 WP_252618828.1 NZ_CP099490:1905400-1905747 [Ornithinimicrobium cryptoxanthini]
MLRGEILLVDLDPVRGSEANKRRPAVLVSNDQANTMAQRLGRGVVTVAPVTSNAERVFPFQVLLPADETGLRMDSKVQAE
QVRSVAVERVGPALGRVPPGLMAAVDEALRLHLQL
MLRGEILLVDLDPVRGSEANKRRPAVLVSNDQANTMAQRLGRGVVTVAPVTSNAERVFPFQVLLPADETGLRMDSKVQAE
QVRSVAVERVGPALGRVPPGLMAAVDEALRLHLQL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|