Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 258626..259286 | Replicon | chromosome |
Accession | NZ_CP099490 | ||
Organism | Ornithinimicrobium cryptoxanthini strain JY.X270 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NF557_RS01225 | Protein ID | WP_252621285.1 |
Coordinates | 258846..259286 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NF557_RS01220 | Protein ID | WP_252621284.1 |
Coordinates | 258626..258853 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF557_RS01200 (NF557_01200) | 255038..255265 | - | 228 | WP_252621281.1 | hypothetical protein | - |
NF557_RS01205 (NF557_01205) | 255265..256440 | - | 1176 | WP_252621282.1 | glycosyltransferase | - |
NF557_RS01210 (NF557_01210) | 256445..258277 | - | 1833 | WP_252621283.1 | phosphoenolpyruvate carboxykinase (GTP) | - |
NF557_RS01220 (NF557_01220) | 258626..258853 | + | 228 | WP_252621284.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NF557_RS01225 (NF557_01225) | 258846..259286 | + | 441 | WP_252621285.1 | hypothetical protein | Toxin |
NF557_RS01230 (NF557_01230) | 259323..259910 | + | 588 | WP_252621286.1 | hypothetical protein | - |
NF557_RS01235 (NF557_01235) | 259952..260824 | + | 873 | WP_252621287.1 | nucleotidyltransferase family protein | - |
NF557_RS01240 (NF557_01240) | 260821..261114 | + | 294 | WP_252621288.1 | PqqD family protein | - |
NF557_RS01245 (NF557_01245) | 261194..262732 | + | 1539 | WP_252621289.1 | polysaccharide biosynthesis tyrosine autokinase | - |
NF557_RS01250 (NF557_01250) | 262829..263899 | + | 1071 | WP_252621290.1 | O-antigen ligase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 15790.06 Da Isoelectric Point: 6.7230
>T248945 WP_252621285.1 NZ_CP099490:258846-259286 [Ornithinimicrobium cryptoxanthini]
MTEPPVTLFDVNALVAVALTTHQHHHAAHRHLRALDGTWATASLTEAGLFRLLLNPLVTGSQRLAADVGAVLQGMRGDPR
WTFLEDATSLADPIVDTTVLMGHRQVTDVHLVNLAARHGGVLATFDAGIRSWLAPEDRHHIVVIPA
MTEPPVTLFDVNALVAVALTTHQHHHAAHRHLRALDGTWATASLTEAGLFRLLLNPLVTGSQRLAADVGAVLQGMRGDPR
WTFLEDATSLADPIVDTTVLMGHRQVTDVHLVNLAARHGGVLATFDAGIRSWLAPEDRHHIVVIPA
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|