Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 4417441..4418057 | Replicon | chromosome |
Accession | NZ_CP099489 | ||
Organism | Ornithinimicrobium sp. HY1793 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NF556_RS20315 | Protein ID | WP_252593020.1 |
Coordinates | 4417668..4418057 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NF556_RS20310 | Protein ID | WP_252593018.1 |
Coordinates | 4417441..4417671 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF556_RS21470 | 4413509..4414006 | - | 498 | WP_289781770.1 | MarR family transcriptional regulator | - |
NF556_RS20305 (NF556_20305) | 4414131..4417370 | + | 3240 | WP_252593016.1 | efflux RND transporter permease subunit | - |
NF556_RS20310 (NF556_20310) | 4417441..4417671 | + | 231 | WP_252593018.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NF556_RS20315 (NF556_20315) | 4417668..4418057 | + | 390 | WP_252593020.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NF556_RS20320 (NF556_20320) | 4418114..4419508 | - | 1395 | WP_252593021.1 | glucose-6-phosphate dehydrogenase | - |
NF556_RS20325 (NF556_20325) | 4419605..4421614 | - | 2010 | WP_252593023.1 | AarF/UbiB family protein | - |
NF556_RS20330 (NF556_20330) | 4421644..4422249 | - | 606 | WP_252593025.1 | maleylpyruvate isomerase family mycothiol-dependent enzyme | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14148.14 Da Isoelectric Point: 6.8800
>T248942 WP_252593020.1 NZ_CP099489:4417668-4418057 [Ornithinimicrobium sp. HY1793]
MTYLLDTHAVLWALTDPARLGPAARQTITARSTRLAVSAATAWEISTKQRIGKLPQADALVGGYSRHLDRLGAIRLPIDE
EHALLAGRLDWSHRDPFDRVFAAQAMLESLTLVTNDSAFAELNGVATLW
MTYLLDTHAVLWALTDPARLGPAARQTITARSTRLAVSAATAWEISTKQRIGKLPQADALVGGYSRHLDRLGAIRLPIDE
EHALLAGRLDWSHRDPFDRVFAAQAMLESLTLVTNDSAFAELNGVATLW
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|