Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 3795458..3796086 | Replicon | chromosome |
Accession | NZ_CP099489 | ||
Organism | Ornithinimicrobium sp. HY1793 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NF556_RS17645 | Protein ID | WP_256829372.1 |
Coordinates | 3795458..3795877 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NF556_RS17650 | Protein ID | WP_252592455.1 |
Coordinates | 3795868..3796086 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF556_RS17620 (NF556_17620) | 3791468..3792394 | + | 927 | WP_252595851.1 | LysR family transcriptional regulator | - |
NF556_RS17625 (NF556_17625) | 3792358..3793761 | - | 1404 | WP_252592446.1 | glutamate mutase L | - |
NF556_RS17630 (NF556_17630) | 3793743..3794033 | - | 291 | WP_252592447.1 | hypothetical protein | - |
NF556_RS17635 (NF556_17635) | 3794187..3794876 | + | 690 | WP_252592449.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
NF556_RS17640 (NF556_17640) | 3794916..3795419 | + | 504 | WP_252592451.1 | ATP-binding protein | - |
NF556_RS17645 (NF556_17645) | 3795458..3795877 | - | 420 | WP_256829372.1 | PIN domain nuclease | Toxin |
NF556_RS17650 (NF556_17650) | 3795868..3796086 | - | 219 | WP_252592455.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
NF556_RS17655 (NF556_17655) | 3796232..3798796 | - | 2565 | WP_252595852.1 | ATP-dependent helicase HrpB | - |
NF556_RS17660 (NF556_17660) | 3798814..3799443 | - | 630 | WP_252592456.1 | class I SAM-dependent methyltransferase | - |
NF556_RS17665 (NF556_17665) | 3799468..3800427 | - | 960 | WP_252592457.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14990.16 Da Isoelectric Point: 5.5672
>T248941 WP_256829372.1 NZ_CP099489:c3795877-3795458 [Ornithinimicrobium sp. HY1793]
VVLTQPWLIDTSAFARLSTSPDAVVWMERIDRGLVRAATVTLLELGYSARSGADWTNGFQQPPLSHVPVENLTPAMEARA
LVVQGLLAERGHHRAAKVPDLIVAATAETAGLTVLHCDKDFDLIADVTGQPVERLRVSA
VVLTQPWLIDTSAFARLSTSPDAVVWMERIDRGLVRAATVTLLELGYSARSGADWTNGFQQPPLSHVPVENLTPAMEARA
LVVQGLLAERGHHRAAKVPDLIVAATAETAGLTVLHCDKDFDLIADVTGQPVERLRVSA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|