Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3587181..3587791 | Replicon | chromosome |
| Accession | NZ_CP099489 | ||
| Organism | Ornithinimicrobium sp. HY1793 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NF556_RS16670 | Protein ID | WP_252592149.1 |
| Coordinates | 3587181..3587585 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NF556_RS16675 | Protein ID | WP_252592151.1 |
| Coordinates | 3587582..3587791 (-) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF556_RS16645 (NF556_16645) | 3582206..3582865 | + | 660 | WP_252592146.1 | helix-turn-helix domain-containing protein | - |
| NF556_RS16650 (NF556_16650) | 3582906..3583844 | - | 939 | WP_252592148.1 | LuxR C-terminal-related transcriptional regulator | - |
| NF556_RS21435 | 3584051..3587077 | + | 3027 | WP_289781758.1 | S8 family peptidase | - |
| NF556_RS16670 (NF556_16670) | 3587181..3587585 | - | 405 | WP_252592149.1 | PIN domain nuclease | Toxin |
| NF556_RS16675 (NF556_16675) | 3587582..3587791 | - | 210 | WP_252592151.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NF556_RS16680 (NF556_16680) | 3587981..3588814 | - | 834 | WP_252592153.1 | fumarylacetoacetate hydrolase family protein | - |
| NF556_RS16685 (NF556_16685) | 3588963..3590987 | + | 2025 | WP_252592155.1 | acetoacetate--CoA ligase | - |
| NF556_RS16690 (NF556_16690) | 3591044..3592243 | + | 1200 | WP_252592156.1 | Fic family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14860.24 Da Isoelectric Point: 6.4641
>T248940 WP_252592149.1 NZ_CP099489:c3587585-3587181 [Ornithinimicrobium sp. HY1793]
VIVDTSAWIEFLRPGPSGAGDQLESLIRKQERLVIPEVVLMELLSGTTDEALAARRRRLIESFELTPTEPIVDSLAAASL
QRMCRRGGESVRNLGDCLIASVALRLDLPVMHRDRDFEVLRRHCGIRTVSLIGA
VIVDTSAWIEFLRPGPSGAGDQLESLIRKQERLVIPEVVLMELLSGTTDEALAARRRRLIESFELTPTEPIVDSLAAASL
QRMCRRGGESVRNLGDCLIASVALRLDLPVMHRDRDFEVLRRHCGIRTVSLIGA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|