Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 593202..593749 | Replicon | chromosome |
| Accession | NZ_CP099489 | ||
| Organism | Ornithinimicrobium sp. HY1793 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NF556_RS02740 | Protein ID | WP_252593974.1 |
| Coordinates | 593202..593531 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NF556_RS02745 | Protein ID | WP_252593975.1 |
| Coordinates | 593528..593749 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF556_RS02710 (NF556_02710) | 588235..589530 | + | 1296 | WP_252593968.1 | lactate racemase domain-containing protein | - |
| NF556_RS02715 (NF556_02715) | 589575..589913 | - | 339 | WP_252593969.1 | helix-turn-helix domain-containing protein | - |
| NF556_RS02720 (NF556_02720) | 590002..590883 | + | 882 | WP_252593970.1 | NAD(P)-binding domain-containing protein | - |
| NF556_RS02725 (NF556_02725) | 590955..591392 | - | 438 | WP_252593971.1 | nuclear transport factor 2 family protein | - |
| NF556_RS02730 (NF556_02730) | 591385..591960 | + | 576 | WP_252593972.1 | DapH/DapD/GlmU-related protein | - |
| NF556_RS02735 (NF556_02735) | 592035..593168 | - | 1134 | WP_252593973.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
| NF556_RS02740 (NF556_02740) | 593202..593531 | - | 330 | WP_252593974.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NF556_RS02745 (NF556_02745) | 593528..593749 | - | 222 | WP_252593975.1 | antitoxin MazE family protein | Antitoxin |
| NF556_RS02750 (NF556_02750) | 593814..595730 | + | 1917 | WP_289781773.1 | chorismate-binding protein | - |
| NF556_RS02755 (NF556_02755) | 595727..596575 | + | 849 | WP_252593976.1 | CoA transferase | - |
| NF556_RS02760 (NF556_02760) | 596652..598208 | + | 1557 | WP_252593977.1 | sodium-dependent transporter | - |
| NF556_RS02765 (NF556_02765) | 598205..598360 | + | 156 | WP_252593978.1 | MetS family NSS transporter small subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11936.95 Da Isoelectric Point: 10.7596
>T248939 WP_252593974.1 NZ_CP099489:c593531-593202 [Ornithinimicrobium sp. HY1793]
VRRGEIFTAAARGPYTGKPRPVVVIQDDRFDATASVTVCPVTTNPVEAPLTRLMIHPTELNGLDQPSRLMVDKVMTMPRT
GLRERVGRLTDGDLVRLNRALIVFLGLAG
VRRGEIFTAAARGPYTGKPRPVVVIQDDRFDATASVTVCPVTTNPVEAPLTRLMIHPTELNGLDQPSRLMVDKVMTMPRT
GLRERVGRLTDGDLVRLNRALIVFLGLAG
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|