Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PHD(antitoxin) |
| Location | 451539..452209 | Replicon | chromosome |
| Accession | NZ_CP099489 | ||
| Organism | Ornithinimicrobium sp. HY1793 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NF556_RS02050 | Protein ID | WP_252593847.1 |
| Coordinates | 451811..452209 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NF556_RS02045 | Protein ID | WP_252593846.1 |
| Coordinates | 451539..451814 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF556_RS02025 (NF556_02025) | 447057..448220 | + | 1164 | WP_252593842.1 | energy-coupling factor transporter transmembrane component T | - |
| NF556_RS02030 (NF556_02030) | 448217..449995 | + | 1779 | WP_252593843.1 | ABC transporter ATP-binding protein | - |
| NF556_RS02035 (NF556_02035) | 449992..450894 | + | 903 | WP_252593844.1 | ECF transporter S component | - |
| NF556_RS02040 (NF556_02040) | 451314..451523 | - | 210 | WP_252593845.1 | hypothetical protein | - |
| NF556_RS02045 (NF556_02045) | 451539..451814 | + | 276 | WP_252593846.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NF556_RS02050 (NF556_02050) | 451811..452209 | + | 399 | WP_252593847.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NF556_RS02055 (NF556_02055) | 452193..453062 | - | 870 | WP_252593848.1 | alpha/beta hydrolase | - |
| NF556_RS02060 (NF556_02060) | 453252..454400 | - | 1149 | WP_252593849.1 | pyridoxal phosphate-dependent aminotransferase | - |
| NF556_RS02065 (NF556_02065) | 454484..455122 | - | 639 | WP_252593850.1 | uracil phosphoribosyltransferase | - |
| NF556_RS02070 (NF556_02070) | 455133..456095 | - | 963 | WP_252593851.1 | WYL domain-containing protein | - |
| NF556_RS02075 (NF556_02075) | 456214..456630 | + | 417 | WP_252593852.1 | VOC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14105.07 Da Isoelectric Point: 5.5213
>T248938 WP_252593847.1 NZ_CP099489:451811-452209 [Ornithinimicrobium sp. HY1793]
VTALYVDSSALCKLVAQEEHTAAMHRLWTTHDGDLVSSDLARTEVMRQAGRCDPPRSTEARAVLDALVLVPVLTRIAQGA
GTLGPPSLRSLDALHLMTALELGDDLAGVVTYDDRQAEAARHLGLPVVTPRS
VTALYVDSSALCKLVAQEEHTAAMHRLWTTHDGDLVSSDLARTEVMRQAGRCDPPRSTEARAVLDALVLVPVLTRIAQGA
GTLGPPSLRSLDALHLMTALELGDDLAGVVTYDDRQAEAARHLGLPVVTPRS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|