Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 75733..76418 | Replicon | plasmid pTT14-2 |
| Accession | NZ_CP099473 | ||
| Organism | Roseomonas mucosa strain TT14 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NF552_RS22500 | Protein ID | WP_252572612.1 |
| Coordinates | 76026..76418 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NF552_RS22495 | Protein ID | WP_252572611.1 |
| Coordinates | 75733..76014 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF552_RS22465 (NF552_22465) | 71011..71451 | - | 441 | WP_252572606.1 | hypothetical protein | - |
| NF552_RS22475 (NF552_22475) | 72855..73013 | - | 159 | WP_252572607.1 | IcmT/TraK family protein | - |
| NF552_RS22480 (NF552_22480) | 73013..74182 | - | 1170 | WP_252572608.1 | ATPase, T2SS/T4P/T4SS family | - |
| NF552_RS22485 (NF552_22485) | 74179..75144 | - | 966 | WP_252572609.1 | type IV secretory system conjugative DNA transfer family protein | - |
| NF552_RS22490 (NF552_22490) | 75137..75610 | - | 474 | WP_252572610.1 | DotD/TraH family lipoprotein | - |
| NF552_RS22495 (NF552_22495) | 75733..76014 | + | 282 | WP_252572611.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NF552_RS22500 (NF552_22500) | 76026..76418 | + | 393 | WP_252572612.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NF552_RS22505 (NF552_22505) | 76469..78667 | - | 2199 | WP_252572613.1 | ATP-binding protein | - |
| NF552_RS22510 (NF552_22510) | 78764..80386 | - | 1623 | WP_252572586.1 | ISL3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..204011 | 204011 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 13668.76 Da Isoelectric Point: 5.8782
>T248935 WP_252572612.1 NZ_CP099473:76026-76418 [Roseomonas mucosa]
MLDTNIVSDLIRNPSGTAARKARAAGAAVCVSIIVAAELRYGCAKKGSPRLLERVEAFLDAVPVMALEVPADAEYGGLRA
ELEAAGQPIGGNDLLIAAHAYALEATLVTANVGEFRRIRGLRVENWLTPG
MLDTNIVSDLIRNPSGTAARKARAAGAAVCVSIIVAAELRYGCAKKGSPRLLERVEAFLDAVPVMALEVPADAEYGGLRA
ELEAAGQPIGGNDLLIAAHAYALEATLVTANVGEFRRIRGLRVENWLTPG
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|