Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 8180441..8180973 | Replicon | chromosome |
Accession | NZ_CP099468 | ||
Organism | Streptomyces phaeoluteigriseus strain Qhu-M197 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NFX46_RS36100 | Protein ID | WP_289782118.1 |
Coordinates | 8180441..8180704 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NFX46_RS36105 | Protein ID | WP_252555145.1 |
Coordinates | 8180701..8180973 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFX46_RS36080 (NFX46_36080) | 8175840..8176997 | - | 1158 | WP_289782117.1 | acyl-CoA dehydrogenase | - |
NFX46_RS36085 (NFX46_36085) | 8177204..8178547 | + | 1344 | WP_252555136.1 | UDP-glucose/GDP-mannose dehydrogenase family protein | - |
NFX46_RS36090 (NFX46_36090) | 8178778..8179185 | + | 408 | WP_252555139.1 | VOC family protein | - |
NFX46_RS36095 (NFX46_36095) | 8179214..8180338 | - | 1125 | WP_252555142.1 | dipeptidase | - |
NFX46_RS36100 (NFX46_36100) | 8180441..8180704 | - | 264 | WP_289782118.1 | Txe/YoeB family addiction module toxin | Toxin |
NFX46_RS36105 (NFX46_36105) | 8180701..8180973 | - | 273 | WP_252555145.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NFX46_RS36110 (NFX46_36110) | 8181051..8182229 | - | 1179 | WP_252555148.1 | dipeptidase | - |
NFX46_RS36115 (NFX46_36115) | 8182235..8182765 | - | 531 | WP_073498506.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
NFX46_RS36120 (NFX46_36120) | 8182762..8183904 | - | 1143 | WP_107439587.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
NFX46_RS36125 (NFX46_36125) | 8184083..8184601 | + | 519 | WP_252555150.1 | GtrA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10499.87 Da Isoelectric Point: 8.5122
>T248933 WP_289782118.1 NZ_CP099468:c8180704-8180441 [Streptomyces phaeoluteigriseus]
VRSVHFDPDAWEDFLFWLGSDRRMARRITRLIGEIQRDPFTGIGKPEPLKGDLSGYWSRRIDDEHRLVYRADDKELKILK
ARYHYHD
VRSVHFDPDAWEDFLFWLGSDRRMARRITRLIGEIQRDPFTGIGKPEPLKGDLSGYWSRRIDDEHRLVYRADDKELKILK
ARYHYHD
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|