Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1249192..1250109 | Replicon | chromosome |
Accession | NZ_CP099465 | ||
Organism | Bacillus velezensis strain Ag75 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NG745_RS06640 | Protein ID | WP_032866111.1 |
Coordinates | 1249363..1250109 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NG745_RS06635 | Protein ID | WP_003154807.1 |
Coordinates | 1249192..1249362 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG745_RS06595 (NG745_06595) | 1244417..1246048 | + | 1632 | WP_060561803.1 | pyocin knob domain-containing protein | - |
NG745_RS06600 (NG745_06600) | 1246061..1246432 | + | 372 | WP_060561802.1 | XkdW family protein | - |
NG745_RS06605 (NG745_06605) | 1246437..1246634 | + | 198 | WP_059367156.1 | XkdX family protein | - |
NG745_RS06610 (NG745_06610) | 1246691..1247451 | + | 761 | Protein_1245 | phage portal protein | - |
NG745_RS06615 (NG745_06615) | 1247503..1247766 | + | 264 | WP_098081338.1 | hemolysin XhlA family protein | - |
NG745_RS06620 (NG745_06620) | 1247780..1248043 | + | 264 | WP_003154813.1 | phage holin | - |
NG745_RS06625 (NG745_06625) | 1248057..1248935 | + | 879 | WP_043021264.1 | N-acetylmuramoyl-L-alanine amidase | - |
NG745_RS06635 (NG745_06635) | 1249192..1249362 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NG745_RS06640 (NG745_06640) | 1249363..1250109 | - | 747 | WP_032866111.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NG745_RS06645 (NG745_06645) | 1250214..1251212 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
NG745_RS06650 (NG745_06650) | 1251225..1251842 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NG745_RS06655 (NG745_06655) | 1252128..1253444 | - | 1317 | WP_007610842.1 | amino acid permease | - |
NG745_RS06660 (NG745_06660) | 1253767..1254717 | + | 951 | WP_098081339.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29095.60 Da Isoelectric Point: 4.7755
>T248931 WP_032866111.1 NZ_CP099465:c1250109-1249363 [Bacillus velezensis]
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|