Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 485683..486320 | Replicon | chromosome |
Accession | NZ_CP099465 | ||
Organism | Bacillus velezensis strain Ag75 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NG745_RS02460 | Protein ID | WP_003156187.1 |
Coordinates | 485970..486320 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NG745_RS02455 | Protein ID | WP_003156188.1 |
Coordinates | 485683..485964 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG745_RS02435 (NG745_02435) | 482048..482647 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NG745_RS02440 (NG745_02440) | 482740..483105 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
NG745_RS02445 (NG745_02445) | 483270..484277 | + | 1008 | WP_098081024.1 | outer membrane lipoprotein carrier protein LolA | - |
NG745_RS02450 (NG745_02450) | 484394..485563 | + | 1170 | WP_098081026.1 | alanine racemase | - |
NG745_RS02455 (NG745_02455) | 485683..485964 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NG745_RS02460 (NG745_02460) | 485970..486320 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NG745_RS02465 (NG745_02465) | 486438..487259 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NG745_RS02470 (NG745_02470) | 487264..487629 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NG745_RS02475 (NG745_02475) | 487632..488033 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NG745_RS02480 (NG745_02480) | 488045..489052 | + | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
NG745_RS02485 (NG745_02485) | 489116..489445 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NG745_RS02490 (NG745_02490) | 489442..489924 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
NG745_RS02495 (NG745_02495) | 489890..490678 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NG745_RS02500 (NG745_02500) | 490678..491280 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T248930 WP_003156187.1 NZ_CP099465:485970-486320 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|