Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
| Location | 5588501..5589297 | Replicon | chromosome |
| Accession | NZ_CP099464 | ||
| Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | NG743_RS25475 | Protein ID | WP_257121136.1 |
| Coordinates | 5588501..5589010 (-) | Length | 170 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | NG743_RS25480 | Protein ID | WP_027401264.1 |
| Coordinates | 5589010..5589297 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG743_RS25440 (NG743_25310) | 5584434..5584718 | + | 285 | WP_027401270.1 | hypothetical protein | - |
| NG743_RS25445 (NG743_25315) | 5584715..5585167 | + | 453 | WP_027401269.1 | hypothetical protein | - |
| NG743_RS25450 (NG743_25320) | 5585211..5585420 | + | 210 | WP_257121134.1 | hypothetical protein | - |
| NG743_RS25455 (NG743_25325) | 5585421..5585870 | + | 450 | WP_051424234.1 | HNH endonuclease signature motif containing protein | - |
| NG743_RS25460 (NG743_25330) | 5586021..5586320 | + | 300 | WP_027401267.1 | type II toxin-antitoxin system HigB family toxin | - |
| NG743_RS25465 (NG743_25335) | 5586333..5586731 | + | 399 | WP_193964778.1 | transcriptional regulator | - |
| NG743_RS25470 (NG743_25340) | 5586935..5588230 | - | 1296 | WP_257121135.1 | RNA-guided endonuclease IscB | - |
| NG743_RS25475 (NG743_25345) | 5588501..5589010 | - | 510 | WP_257121136.1 | GNAT family N-acetyltransferase | Toxin |
| NG743_RS25480 (NG743_25350) | 5589010..5589297 | - | 288 | WP_027401264.1 | DUF1778 domain-containing protein | Antitoxin |
| NG743_RS25485 (NG743_25355) | 5589589..5589711 | - | 123 | WP_027400631.1 | histone H1 | - |
| NG743_RS25490 (NG743_25360) | 5589843..5591318 | + | 1476 | WP_052149947.1 | RNA-guided endonuclease TnpB family protein | - |
| NG743_RS25495 (NG743_25365) | 5591257..5591457 | - | 201 | WP_257121137.1 | aldo/keto reductase | - |
| NG743_RS25500 (NG743_25370) | 5591761..5592423 | - | 663 | WP_257121138.1 | dienelactone hydrolase family protein | - |
| NG743_RS25505 (NG743_25375) | 5592585..5594123 | - | 1539 | WP_257121139.1 | amidohydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 170 a.a. Molecular weight: 19299.27 Da Isoelectric Point: 5.8089
>T248929 WP_257121136.1 NZ_CP099464:c5589010-5588501 [Dolichospermum heterosporum TAC447]
MVLKIELLDSSRHIRTEFCCGKDSLDNYLYKQASQDLKKRVATVFVLIDEPDSHVLAYYTLSAYTVDITVLDEAFAKRLP
RYPYLPATLLGRLAVDNRQKGQGFGELMLVDALKRAFNASRQVGSLAVIAEALDEEVVNFYIKYGFKEFKQNSMKLYIPM
QSVEELVQD
MVLKIELLDSSRHIRTEFCCGKDSLDNYLYKQASQDLKKRVATVFVLIDEPDSHVLAYYTLSAYTVDITVLDEAFAKRLP
RYPYLPATLLGRLAVDNRQKGQGFGELMLVDALKRAFNASRQVGSLAVIAEALDEEVVNFYIKYGFKEFKQNSMKLYIPM
QSVEELVQD
Download Length: 510 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|