Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
Location | 5230150..5230657 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | relB | Uniprot ID | A0A6H2BW57 |
Locus tag | NG743_RS23875 | Protein ID | WP_027401524.1 |
Coordinates | 5230150..5230410 (-) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A6H2BVA9 |
Locus tag | NG743_RS23880 | Protein ID | WP_027401523.1 |
Coordinates | 5230403..5230657 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS23855 (NG743_23740) | 5225161..5226282 | + | 1122 | WP_257121035.1 | bacteriohopanetetrol glucosamine biosynthesis glycosyltransferase HpnI | - |
NG743_RS23860 (NG743_23745) | 5227067..5227684 | - | 618 | WP_257121036.1 | CAP family protein | - |
NG743_RS23865 (NG743_23750) | 5227797..5228540 | + | 744 | WP_027401526.1 | sirohydrochlorin chelatase | - |
NG743_RS23870 (NG743_23755) | 5228533..5229288 | + | 756 | WP_193964702.1 | uroporphyrinogen-III C-methyltransferase | - |
NG743_RS23875 (NG743_23760) | 5230150..5230410 | - | 261 | WP_027401524.1 | Txe/YoeB family addiction module toxin | Toxin |
NG743_RS23880 (NG743_23765) | 5230403..5230657 | - | 255 | WP_027401523.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NG743_RS23885 (NG743_23770) | 5230834..5231133 | + | 300 | WP_257121037.1 | hypothetical protein | - |
NG743_RS23890 (NG743_23775) | 5231408..5231530 | + | 123 | WP_236630549.1 | hypothetical protein | - |
NG743_RS23895 (NG743_23780) | 5231937..5232122 | + | 186 | WP_152540422.1 | hypothetical protein | - |
NG743_RS23900 | 5232849..5232974 | - | 126 | WP_257121038.1 | hypothetical protein | - |
NG743_RS23905 (NG743_23785) | 5233012..5234289 | + | 1278 | WP_257121039.1 | phosphoribosylamine--glycine ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10336.87 Da Isoelectric Point: 7.9759
>T248928 WP_027401524.1 NZ_CP099464:c5230410-5230150 [Dolichospermum heterosporum TAC447]
MSRMLAWTDEAWGNYLYWQGQDKKTLKRINKLIEETMRMPFEGIGKPEPLKENLAGFWSRRIDDTNRLVYAVDDVYVTII
SCRYHY
MSRMLAWTDEAWGNYLYWQGQDKKTLKRINKLIEETMRMPFEGIGKPEPLKENLAGFWSRRIDDTNRLVYAVDDVYVTII
SCRYHY
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H2BW57 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6H2BVA9 |