Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4484303..4485090 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | NG743_RS20315 | Protein ID | WP_257120766.1 |
Coordinates | 4484590..4485090 (+) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A0K2LWK8 |
Locus tag | NG743_RS20310 | Protein ID | WP_053538439.1 |
Coordinates | 4484303..4484593 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS20280 (NG743_20180) | 4479489..4479944 | + | 456 | WP_027402083.1 | 50S ribosomal protein L13 | - |
NG743_RS20285 (NG743_20185) | 4479944..4480360 | + | 417 | WP_027402082.1 | 30S ribosomal protein S9 | - |
NG743_RS20290 (NG743_20190) | 4480470..4480712 | + | 243 | WP_027402081.1 | 50S ribosomal protein L31 | - |
NG743_RS20295 (NG743_20195) | 4480834..4481934 | + | 1101 | WP_027402080.1 | peptide chain release factor 1 | - |
NG743_RS20300 (NG743_20200) | 4482070..4482570 | - | 501 | WP_027402079.1 | 2TM domain-containing protein | - |
NG743_RS20305 (NG743_20205) | 4482983..4483882 | - | 900 | WP_027402078.1 | M48 family metallopeptidase | - |
NG743_RS20310 (NG743_20210) | 4484303..4484593 | + | 291 | WP_053538439.1 | DUF1778 domain-containing protein | Antitoxin |
NG743_RS20315 (NG743_20215) | 4484590..4485090 | + | 501 | WP_257120766.1 | GNAT family N-acetyltransferase | Toxin |
NG743_RS20320 (NG743_20220) | 4485165..4486883 | - | 1719 | WP_257120767.1 | ABC transporter ATP-binding protein | - |
NG743_RS20325 (NG743_20225) | 4487011..4487634 | - | 624 | WP_027402073.1 | exopolysaccharide biosynthesis protein | - |
NG743_RS20330 (NG743_20230) | 4487674..4487811 | - | 138 | WP_257120768.1 | hypothetical protein | - |
NG743_RS20335 (NG743_20235) | 4487906..4488688 | + | 783 | WP_257120769.1 | ABC transporter permease | - |
NG743_RS20340 (NG743_20240) | 4488789..4489508 | - | 720 | WP_257120770.1 | Uma2 family endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18114.89 Da Isoelectric Point: 7.2134
>T248926 WP_257120766.1 NZ_CP099464:4484590-4485090 [Dolichospermum heterosporum TAC447]
MSLTPPETLSSHHSCSDFSCGIASLDDWLKRRAYTNQISGATRTFVLCVDNRIVGYYALASGAISVQSALGKFRRNMPDP
IPVVILARLAIDSSYQSQGLGRALFRDAALRVVQAADTIGIRGIIVHAISEEAKDFYLALGFILSPLEPMTLMISLNDLR
DSIPEK
MSLTPPETLSSHHSCSDFSCGIASLDDWLKRRAYTNQISGATRTFVLCVDNRIVGYYALASGAISVQSALGKFRRNMPDP
IPVVILARLAIDSSYQSQGLGRALFRDAALRVVQAADTIGIRGIIVHAISEEAKDFYLALGFILSPLEPMTLMISLNDLR
DSIPEK
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|