248925

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-MazE
Location 4380140..4380769 Replicon chromosome
Accession NZ_CP099464
Organism Dolichospermum heterosporum TAC447 strain NIES-1697

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NG743_RS19730 Protein ID WP_027402371.1
Coordinates 4380140..4380541 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NG743_RS19735 Protein ID WP_027402372.1
Coordinates 4380542..4380769 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NG743_RS19710 (NG743_19615) 4375734..4376090 + 357 WP_257120721.1 heterocyst frequency control protein PatD -
NG743_RS19715 (NG743_19620) 4376495..4377742 + 1248 WP_027402368.1 hypothetical protein -
NG743_RS19720 (NG743_19625) 4377910..4378239 + 330 WP_027402369.1 thioredoxin -
NG743_RS19725 (NG743_19630) 4378251..4379750 - 1500 WP_027402370.1 family 10 glycosylhydrolase -
NG743_RS19730 (NG743_19635) 4380140..4380541 - 402 WP_027402371.1 type II toxin-antitoxin system VapC family toxin Toxin
NG743_RS19735 (NG743_19640) 4380542..4380769 - 228 WP_027402372.1 virulence factor Antitoxin
NG743_RS19740 (NG743_19645) 4380861..4381175 - 315 WP_228043747.1 type II toxin-antitoxin system VapC family toxin -
NG743_RS19745 (NG743_19650) 4381168..4381410 - 243 WP_257120722.1 hypothetical protein -
NG743_RS19750 (NG743_19655) 4381935..4382471 + 537 WP_257120723.1 hypothetical protein -
NG743_RS19755 (NG743_19660) 4383073..4383474 - 402 WP_027402374.1 type II toxin-antitoxin system VapC family toxin -
NG743_RS19760 (NG743_19665) 4383462..4383683 - 222 WP_027402375.1 hypothetical protein -
NG743_RS19765 (NG743_19670) 4384196..4384363 - 168 WP_168204374.1 hypothetical protein -
NG743_RS19770 (NG743_19675) 4384367..4384657 - 291 WP_257120724.1 type II toxin-antitoxin system VapC family toxin -
NG743_RS19775 (NG743_19680) 4384658..4384840 - 183 WP_257120725.1 hypothetical protein -
NG743_RS19780 (NG743_19685) 4385204..4385554 - 351 WP_201769136.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-125)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 15042.56 Da        Isoelectric Point: 5.1546

>T248925 WP_027402371.1 NZ_CP099464:c4380541-4380140 [Dolichospermum heterosporum TAC447]
MQYLLDTNICIYLIKQKPEKVIARFQTLSISDIGISSITVAELEYGVYKSQQQEKNKNALMQFLLPLEIIEFSQNAAVIY
GYIRSDLESKGLVIGPMDMLIAAHAMSLGVTLVTNNIREFSRIPKLSLENWAE

Download         Length: 402 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8606.84 Da        Isoelectric Point: 4.4536

>AT248925 WP_027402372.1 NZ_CP099464:c4380769-4380542 [Dolichospermum heterosporum TAC447]
MNTAKLSSDGTHQMVILPTDFKMTGTEVYVKKIGNAIILISKDNPWQTLIDSLDQFSDDFLMTRDQLPIDKREEF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References