Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3854490..3855058 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NG743_RS17200 | Protein ID | WP_039201266.1 |
Coordinates | 3854490..3854825 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1Z4V8H8 |
Locus tag | NG743_RS17205 | Protein ID | WP_027402546.1 |
Coordinates | 3854819..3855058 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS17180 (NG743_17090) | 3849938..3850777 | - | 840 | WP_027402547.1 | DUF2887 domain-containing protein | - |
NG743_RS17185 (NG743_17095) | 3850868..3851095 | - | 228 | WP_152608969.1 | hypothetical protein | - |
NG743_RS17190 (NG743_17100) | 3851608..3852453 | - | 846 | WP_257120532.1 | DUF2887 domain-containing protein | - |
NG743_RS17195 (NG743_17105) | 3852710..3853627 | - | 918 | WP_257120533.1 | DUF2887 domain-containing protein | - |
NG743_RS17200 (NG743_17110) | 3854490..3854825 | - | 336 | WP_039201266.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NG743_RS17205 (NG743_17115) | 3854819..3855058 | - | 240 | WP_027402546.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NG743_RS17210 (NG743_17120) | 3855738..3856000 | - | 263 | Protein_3402 | hypothetical protein | - |
NG743_RS17215 (NG743_17125) | 3856142..3856609 | - | 468 | WP_027402545.1 | DUF29 domain-containing protein | - |
NG743_RS17220 (NG743_17130) | 3857900..3858808 | - | 909 | WP_193964719.1 | DUF4351 domain-containing protein | - |
NG743_RS17225 (NG743_17135) | 3859015..3859161 | - | 147 | WP_152540446.1 | SAF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12948.08 Da Isoelectric Point: 7.7001
>T248923 WP_039201266.1 NZ_CP099464:c3854825-3854490 [Dolichospermum heterosporum TAC447]
MVDYVPRYGDLVWLNFDPQSGHEQMGQRPALVLSHTEFNQQRGFIFVCPISNTKRKNPFYVEIPDDQPIKGVVMCDQLRS
LDYRSRKAKLICICPEWLLAEVLGRIHPILF
MVDYVPRYGDLVWLNFDPQSGHEQMGQRPALVLSHTEFNQQRGFIFVCPISNTKRKNPFYVEIPDDQPIKGVVMCDQLRS
LDYRSRKAKLICICPEWLLAEVLGRIHPILF
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|