Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
| Location | 3578519..3579078 | Replicon | chromosome |
| Accession | NZ_CP099464 | ||
| Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NG743_RS16045 | Protein ID | WP_027403706.1 |
| Coordinates | 3578740..3579078 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NG743_RS16040 | Protein ID | WP_027403705.1 |
| Coordinates | 3578519..3578743 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG743_RS16010 (NG743_15925) | 3573602..3573796 | + | 195 | WP_257120424.1 | DUF433 domain-containing protein | - |
| NG743_RS16015 (NG743_15930) | 3573793..3574308 | + | 516 | WP_257120425.1 | hypothetical protein | - |
| NG743_RS16020 (NG743_15935) | 3574494..3576140 | - | 1647 | WP_027403701.1 | Ppx/GppA phosphatase family protein | - |
| NG743_RS16025 (NG743_15940) | 3576232..3577113 | + | 882 | WP_027403702.1 | 4-hydroxybenzoate solanesyltransferase | - |
| NG743_RS16030 (NG743_15945) | 3577239..3577817 | + | 579 | WP_027403703.1 | hypothetical protein | - |
| NG743_RS16035 (NG743_15950) | 3578295..3578486 | + | 192 | WP_027403704.1 | hypothetical protein | - |
| NG743_RS16040 (NG743_15955) | 3578519..3578743 | + | 225 | WP_027403705.1 | DUF433 domain-containing protein | Antitoxin |
| NG743_RS16045 (NG743_15960) | 3578740..3579078 | + | 339 | WP_027403706.1 | DUF5615 family PIN-like protein | Toxin |
| NG743_RS16050 (NG743_15965) | 3579763..3580065 | + | 303 | WP_152540481.1 | hypothetical protein | - |
| NG743_RS16055 (NG743_15970) | 3580010..3581137 | + | 1128 | WP_257120426.1 | hypothetical protein | - |
| NG743_RS16060 (NG743_15975) | 3581361..3581585 | + | 225 | WP_027403709.1 | type II toxin-antitoxin system HicA family toxin | - |
| NG743_RS16065 (NG743_15980) | 3581582..3581809 | + | 228 | WP_027403710.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NG743_RS16070 (NG743_15985) | 3581865..3582197 | - | 333 | WP_027403711.1 | DUF86 domain-containing protein | - |
| NG743_RS16075 (NG743_15990) | 3582194..3582484 | - | 291 | WP_027403712.1 | nucleotidyltransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12726.86 Da Isoelectric Point: 4.8101
>T248922 WP_027403706.1 NZ_CP099464:3578740-3579078 [Dolichospermum heterosporum TAC447]
MKIWIDAQLPPTLADWITNTFAIEAFSLKEIGLRDAKDIDIFEAAKIANVIIMTKDSDFVDLVCRLGTPPQIIWLTCGNV
TNRNLRQLLNFTLHDALEKLRQGEMIVEINKS
MKIWIDAQLPPTLADWITNTFAIEAFSLKEIGLRDAKDIDIFEAAKIANVIIMTKDSDFVDLVCRLGTPPQIIWLTCGNV
TNRNLRQLLNFTLHDALEKLRQGEMIVEINKS
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|