Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/- |
Location | 2664799..2665387 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NG743_RS12020 | Protein ID | WP_257122038.1 |
Coordinates | 2665034..2665387 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NG743_RS12015 | Protein ID | WP_027403032.1 |
Coordinates | 2664799..2665041 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS11980 (NG743_11915) | 2660201..2661145 | + | 945 | WP_193963064.1 | glycosyltransferase | - |
NG743_RS11985 (NG743_11920) | 2661230..2662654 | + | 1425 | WP_027403028.1 | O-antigen ligase family protein | - |
NG743_RS11990 (NG743_11925) | 2663021..2663458 | + | 438 | WP_027403029.1 | hypothetical protein | - |
NG743_RS11995 (NG743_11930) | 2663555..2663800 | + | 246 | WP_027403030.1 | hypothetical protein | - |
NG743_RS12000 (NG743_11935) | 2663818..2664003 | + | 186 | WP_201769151.1 | hypothetical protein | - |
NG743_RS12005 (NG743_11940) | 2664125..2664283 | + | 159 | Protein_2377 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NG743_RS12010 (NG743_11945) | 2664449..2664670 | - | 222 | WP_027403031.1 | prevent-host-death protein | - |
NG743_RS12015 (NG743_11950) | 2664799..2665041 | + | 243 | WP_027403032.1 | hypothetical protein | Antitoxin |
NG743_RS12020 (NG743_11955) | 2665034..2665387 | + | 354 | WP_257122038.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NG743_RS12025 (NG743_11960) | 2665683..2666642 | - | 960 | WP_193965010.1 | IS110 family transposase | - |
NG743_RS12030 (NG743_11965) | 2667806..2668687 | + | 882 | WP_257122039.1 | aspartoacylase | - |
NG743_RS12035 (NG743_11970) | 2668670..2669800 | - | 1131 | WP_257122040.1 | glycosyltransferase family 4 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13579.72 Da Isoelectric Point: 9.1846
>T248920 WP_257122038.1 NZ_CP099464:2665034-2665387 [Dolichospermum heterosporum TAC447]
MNNINPISIRFSPEFEKQLYKLSKRYRKIRDYIQPVIVQLQEGEITGDRLVGLGEEYQVYKVRVKNSNIQKGKSGGYRLI
YYLQTATSIILLTVYSKCDQEDIAVTVIQGIIEQVME
MNNINPISIRFSPEFEKQLYKLSKRYRKIRDYIQPVIVQLQEGEITGDRLVGLGEEYQVYKVRVKNSNIQKGKSGGYRLI
YYLQTATSIILLTVYSKCDQEDIAVTVIQGIIEQVME
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|