Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
Location | 2206517..2207216 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | NG743_RS09820 | Protein ID | WP_257122139.1 |
Coordinates | 2206517..2206897 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | NG743_RS09825 | Protein ID | WP_027402638.1 |
Coordinates | 2206890..2207216 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS09785 (NG743_09735) | 2201556..2202620 | + | 1065 | WP_193963740.1 | metal-dependent hydrolase | - |
NG743_RS09790 (NG743_09740) | 2202639..2203481 | + | 843 | WP_257121920.1 | pentapeptide repeat-containing protein | - |
NG743_RS09795 (NG743_09745) | 2204190..2204387 | + | 198 | WP_027402632.1 | pentapeptide repeat-containing protein | - |
NG743_RS09800 (NG743_09750) | 2204742..2205020 | + | 279 | WP_027402633.1 | hypothetical protein | - |
NG743_RS09805 (NG743_09755) | 2205231..2205545 | + | 315 | WP_027402634.1 | helix-turn-helix transcriptional regulator | - |
NG743_RS09810 (NG743_09760) | 2205535..2206080 | + | 546 | WP_027402635.1 | pentapeptide repeat-containing protein | - |
NG743_RS09815 (NG743_09765) | 2206173..2206367 | + | 195 | WP_236630580.1 | hypothetical protein | - |
NG743_RS09820 (NG743_09770) | 2206517..2206897 | + | 381 | WP_257122139.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NG743_RS09825 (NG743_09775) | 2206890..2207216 | + | 327 | WP_027402638.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NG743_RS09830 (NG743_09780) | 2207384..2207611 | + | 228 | WP_027402639.1 | DUF87 domain-containing protein | - |
NG743_RS09835 (NG743_09785) | 2208171..2208764 | + | 594 | WP_257121921.1 | hypothetical protein | - |
NG743_RS09840 (NG743_09790) | 2209313..2209654 | + | 342 | WP_027402640.1 | hypothetical protein | - |
NG743_RS09845 (NG743_09795) | 2209671..2210336 | - | 666 | WP_257121922.1 | DUF2834 domain-containing protein | - |
NG743_RS09850 (NG743_09800) | 2210350..2211426 | - | 1077 | WP_027402642.1 | heat-inducible transcriptional repressor HrcA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14212.15 Da Isoelectric Point: 6.4880
>T248918 WP_257122139.1 NZ_CP099464:2206517-2206897 [Dolichospermum heterosporum TAC447]
INEKPLKWVASALDDLKEFPEDVQDVMGYALDLAQHGQKHPDAKPLKGFPESGVVEIVDDFDGDTYRAIYTVKFKGVIYL
LHSFQKKSKHGIATPQQDIDLVRKRLKTAELDYLQETAQKNGVKNG
INEKPLKWVASALDDLKEFPEDVQDVMGYALDLAQHGQKHPDAKPLKGFPESGVVEIVDDFDGDTYRAIYTVKFKGVIYL
LHSFQKKSKHGIATPQQDIDLVRKRLKTAELDYLQETAQKNGVKNG
Download Length: 381 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 11898.72 Da Isoelectric Point: 9.0771
>AT248918 WP_027402638.1 NZ_CP099464:2206890-2207216 [Dolichospermum heterosporum TAC447]
MDSENRITVSSGNVFADLGLANSEERLLKAELARKISEIINSQKLTQVQAAEILGIDQPKVSLLIRGRLSGFSTDRLMAY
LNKLGSDVEITVKPKPENHKFARTTVVC
MDSENRITVSSGNVFADLGLANSEERLLKAELARKISEIINSQKLTQVQAAEILGIDQPKVSLLIRGRLSGFSTDRLMAY
LNKLGSDVEITVKPKPENHKFARTTVVC
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|