Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 1920178..1920664 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NG743_RS08755 | Protein ID | WP_027403973.1 |
Coordinates | 1920401..1920664 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NG743_RS08750 | Protein ID | WP_027403974.1 |
Coordinates | 1920178..1920411 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS08715 (NG743_08680) | 1915496..1916014 | - | 519 | WP_027400593.1 | DUF29 family protein | - |
NG743_RS08720 (NG743_08685) | 1916068..1916301 | - | 234 | WP_096664968.1 | CopG family antitoxin | - |
NG743_RS08725 (NG743_08690) | 1916412..1916741 | - | 330 | WP_193964480.1 | helix-turn-helix transcriptional regulator | - |
NG743_RS08730 (NG743_08695) | 1916752..1917111 | - | 360 | WP_193964482.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NG743_RS08735 (NG743_08700) | 1917119..1918948 | - | 1830 | WP_051424193.1 | WG repeat-containing protein | - |
NG743_RS08740 (NG743_08705) | 1919347..1919622 | + | 276 | WP_027403976.1 | type II toxin-antitoxin system HicA family toxin | - |
NG743_RS08745 (NG743_08710) | 1919588..1919968 | + | 381 | WP_027403975.1 | toxin-antitoxin system HicB family antitoxin | - |
NG743_RS08750 (NG743_08715) | 1920178..1920411 | - | 234 | WP_027403974.1 | CopG family antitoxin | Antitoxin |
NG743_RS08755 (NG743_08720) | 1920401..1920664 | - | 264 | WP_027403973.1 | BrnT family toxin | Toxin |
NG743_RS08760 (NG743_08725) | 1920768..1923710 | - | 2943 | WP_257121853.1 | serine/threonine-protein kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10224.56 Da Isoelectric Point: 7.3186
>T248917 WP_027403973.1 NZ_CP099464:c1920664-1920401 [Dolichospermum heterosporum TAC447]
MMEFEFDANKSATNKTKHNIDFIEAQKLWRDTHLVEVPANTTDEPRFLVIGKIADKHWSAVITYRSDKIRIISVRRSRTE
EANIYES
MMEFEFDANKSATNKTKHNIDFIEAQKLWRDTHLVEVPANTTDEPRFLVIGKIADKHWSAVITYRSDKIRIISVRRSRTE
EANIYES
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|