Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RHH |
| Location | 1749235..1749745 | Replicon | chromosome |
| Accession | NZ_CP099464 | ||
| Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NG743_RS07925 | Protein ID | WP_027404113.1 |
| Coordinates | 1749235..1749513 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NG743_RS07930 | Protein ID | WP_257121822.1 |
| Coordinates | 1749503..1749745 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NG743_RS07895 (NG743_07860) | 1744376..1744648 | - | 273 | WP_027404119.1 | hypothetical protein | - |
| NG743_RS07900 (NG743_07865) | 1744702..1745748 | - | 1047 | WP_027404118.1 | ABC transporter permease | - |
| NG743_RS07905 (NG743_07870) | 1745922..1746440 | - | 519 | WP_027404117.1 | adenine phosphoribosyltransferase | - |
| NG743_RS07910 (NG743_07875) | 1746726..1747352 | + | 627 | WP_027404116.1 | DUF3038 domain-containing protein | - |
| NG743_RS07915 (NG743_07880) | 1747363..1748793 | + | 1431 | WP_027404115.1 | DUF4335 domain-containing protein | - |
| NG743_RS07920 (NG743_07885) | 1748919..1749194 | + | 276 | WP_027404114.1 | lipopolysaccharide assembly protein LapA domain-containing protein | - |
| NG743_RS07925 (NG743_07890) | 1749235..1749513 | - | 279 | WP_027404113.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| NG743_RS07930 (NG743_07895) | 1749503..1749745 | - | 243 | WP_257121822.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| NG743_RS07935 (NG743_07900) | 1749946..1750224 | + | 279 | WP_027404111.1 | transcriptional regulator | - |
| NG743_RS07940 (NG743_07905) | 1750276..1750707 | + | 432 | WP_257121823.1 | DUF29 domain-containing protein | - |
| NG743_RS07945 (NG743_07910) | 1750783..1751829 | - | 1047 | WP_027404109.1 | Type 1 glutamine amidotransferase-like domain-containing protein | - |
| NG743_RS07950 (NG743_07915) | 1751955..1753142 | - | 1188 | WP_027404108.1 | glycosyltransferase family 4 protein | - |
| NG743_RS07955 (NG743_07920) | 1753503..1754078 | - | 576 | WP_257121824.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| NG743_RS07960 (NG743_07925) | 1754132..1754461 | + | 330 | WP_027404106.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10843.58 Da Isoelectric Point: 10.1944
>T248916 WP_027404113.1 NZ_CP099464:c1749513-1749235 [Dolichospermum heterosporum TAC447]
MRVKWLRQALRNLKQAHNYVFPENPTAAQELILKIQNAANQLENYPFMGKSGRVDGTRELIISNSPYMIIYRVKEETVEI
LRILHTSKRYPE
MRVKWLRQALRNLKQAHNYVFPENPTAAQELILKIQNAANQLENYPFMGKSGRVDGTRELIISNSPYMIIYRVKEETVEI
LRILHTSKRYPE
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|