Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1565121..1565670 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NG743_RS07135 | Protein ID | WP_027404251.1 |
Coordinates | 1565332..1565670 (+) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NG743_RS07130 | Protein ID | WP_027404252.1 |
Coordinates | 1565121..1565345 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS07115 (NG743_07095) | 1560888..1562479 | - | 1592 | Protein_1416 | IS1634 family transposase | - |
NG743_RS07120 (NG743_07100) | 1563098..1564066 | - | 969 | WP_257121760.1 | arsenosugar biosynthesis arsenite methyltransferase ArsM | - |
NG743_RS07125 (NG743_07105) | 1564346..1564963 | + | 618 | WP_027404253.1 | TMEM165/GDT1 family protein | - |
NG743_RS07130 (NG743_07110) | 1565121..1565345 | + | 225 | WP_027404252.1 | CopG family transcriptional regulator | Antitoxin |
NG743_RS07135 (NG743_07115) | 1565332..1565670 | + | 339 | WP_027404251.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NG743_RS07140 (NG743_07120) | 1565887..1566021 | + | 135 | Protein_1421 | TMEM165/GDT1 family protein | - |
NG743_RS07145 (NG743_07125) | 1566106..1566483 | - | 378 | WP_257122127.1 | TaqI-like C-terminal specificity domain-containing protein | - |
NG743_RS07150 (NG743_07130) | 1566556..1567008 | - | 453 | WP_257121761.1 | hypothetical protein | - |
NG743_RS07155 (NG743_07135) | 1567037..1567813 | - | 777 | WP_257121762.1 | hypothetical protein | - |
NG743_RS07160 (NG743_07140) | 1568347..1569240 | - | 894 | WP_193962915.1 | tetratricopeptide repeat protein | - |
NG743_RS07165 (NG743_07145) | 1569632..1570624 | + | 993 | WP_027404248.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12339.23 Da Isoelectric Point: 6.9774
>T248915 WP_027404251.1 NZ_CP099464:1565332-1565670 [Dolichospermum heterosporum TAC447]
MKRGEIYLANLSPAVGSEMDKRRPVLIVSNDANNNASTTVTIVPITSNMSRVYPFEVLLNPEDSGLYKTSKVQAQQIRTI
SKQRILGDVVGCLSQELIDLVNDAIKLHLALE
MKRGEIYLANLSPAVGSEMDKRRPVLIVSNDANNNASTTVTIVPITSNMSRVYPFEVLLNPEDSGLYKTSKVQAQQIRTI
SKQRILGDVVGCLSQELIDLVNDAIKLHLALE
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|