Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 1376970..1377797 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | NG743_RS06115 | Protein ID | WP_257121705.1 |
Coordinates | 1377225..1377797 (+) | Length | 191 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | - |
Locus tag | NG743_RS06110 | Protein ID | WP_257121704.1 |
Coordinates | 1376970..1377224 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS06090 (NG743_06070) | 1373375..1374334 | - | 960 | WP_193965010.1 | IS110 family transposase | - |
NG743_RS06095 (NG743_06075) | 1374716..1375018 | + | 303 | WP_257121702.1 | type II toxin-antitoxin system PrlF family antitoxin | - |
NG743_RS06100 (NG743_06080) | 1375015..1375488 | + | 474 | WP_257121703.1 | type II toxin-antitoxin system YhaV family toxin | - |
NG743_RS06105 (NG743_06085) | 1375689..1376909 | + | 1221 | WP_027400610.1 | ISL3 family transposase | - |
NG743_RS06110 (NG743_06090) | 1376970..1377224 | + | 255 | WP_257121704.1 | helix-turn-helix domain-containing protein | Antitoxin |
NG743_RS06115 (NG743_06095) | 1377225..1377797 | + | 573 | WP_257121705.1 | PIN domain-containing protein | Toxin |
NG743_RS06120 (NG743_06100) | 1377924..1378205 | + | 282 | WP_027404402.1 | antibiotic biosynthesis monooxygenase | - |
NG743_RS06125 (NG743_06105) | 1378230..1380371 | - | 2142 | WP_257121706.1 | serine/threonine-protein kinase | - |
NG743_RS06130 (NG743_06110) | 1380921..1381337 | + | 417 | WP_257121707.1 | helix-turn-helix domain-containing protein | - |
NG743_RS06135 (NG743_06115) | 1381401..1382012 | + | 612 | WP_257120845.1 | IS607 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1375689..1376909 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 191 a.a. Molecular weight: 21954.63 Da Isoelectric Point: 5.0559
>T248914 WP_257121705.1 NZ_CP099464:1377225-1377797 [Dolichospermum heterosporum TAC447]
MQAIGLIVVYDACVLYPAPLRDFLMWLALTDLFQAKWTEKIHEEWMNYVLKNRPDLTYKQLERTKKLMNQNVRDCLVTGY
EQLIDELELPDADDRHVLAAAIKSDAEIIVTFNLKDFLSENIGQYGIKAQHPDEFILHLINLNSDLVCQAVKNQLNTLKK
PPINLDELLEILIKQQIPKSVSVLQKLLIN
MQAIGLIVVYDACVLYPAPLRDFLMWLALTDLFQAKWTEKIHEEWMNYVLKNRPDLTYKQLERTKKLMNQNVRDCLVTGY
EQLIDELELPDADDRHVLAAAIKSDAEIIVTFNLKDFLSENIGQYGIKAQHPDEFILHLINLNSDLVCQAVKNQLNTLKK
PPINLDELLEILIKQQIPKSVSVLQKLLIN
Download Length: 573 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|