Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/- |
Location | 767122..767704 | Replicon | chromosome |
Accession | NZ_CP099464 | ||
Organism | Dolichospermum heterosporum TAC447 strain NIES-1697 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NG743_RS03425 | Protein ID | WP_257121522.1 |
Coordinates | 767354..767704 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NG743_RS03420 | Protein ID | WP_027404857.1 |
Coordinates | 767122..767364 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NG743_RS03410 (NG743_03390) | 765472..765762 | - | 291 | WP_193896423.1 | nucleotidyltransferase family protein | - |
NG743_RS03415 (NG743_03395) | 766047..766949 | - | 903 | WP_027404858.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
NG743_RS03420 (NG743_03400) | 767122..767364 | + | 243 | WP_027404857.1 | hypothetical protein | Antitoxin |
NG743_RS03425 (NG743_03405) | 767354..767704 | + | 351 | WP_257121522.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NG743_RS03430 (NG743_03410) | 767794..771270 | - | 3477 | WP_257121523.1 | Eco57I restriction-modification methylase domain-containing protein | - |
NG743_RS03435 (NG743_03415) | 771362..771808 | - | 447 | WP_027404854.1 | DUF29 domain-containing protein | - |
NG743_RS03440 (NG743_03420) | 771846..772295 | - | 450 | WP_027404853.1 | DUF29 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13356.39 Da Isoelectric Point: 9.3258
>T248912 WP_257121522.1 NZ_CP099464:767354-767704 [Dolichospermum heterosporum TAC447]
MLSETPFVIVNFTDNFKQKIRSLSKKYRHIRNDIQPIIEELQSGNFLGDQISGTGYTVLKVRVRNSDIQKGKSSGYRIIY
QIESPTNVLLLLIYSKLEQTDVTMDEIKSVIELFQA
MLSETPFVIVNFTDNFKQKIRSLSKKYRHIRNDIQPIIEELQSGNFLGDQISGTGYTVLKVRVRNSDIQKGKSSGYRIIY
QIESPTNVLLLLIYSKLEQTDVTMDEIKSVIELFQA
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|